KEGG   Bacillus velezensis UCMB5036: BAM5036_0313Help
Entry
BAM5036_0313      CDS       T02480                                 

Gene name
nasA
Definition
(GenBank) putative nitrate transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
baml  Bacillus velezensis UCMB5036
Pathway
baml00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:baml00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BAM5036_0313 (nasA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:baml02000]
    BAM5036_0313 (nasA)
Transporters [BR:baml02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    BAM5036_0313 (nasA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 LacY_symp
Motif
Other DBs
NCBI-ProteinID: CCP20376
LinkDB All DBs
Position
335184..336389
Genome map
AA seq 401 aa AA seqDB search
MKLSELKTSGHPLTLLCSFLYFDVSFMIWVMLGALGVYISQDFGLSSFEKGFVVALPILS
GSVFRIILGVLTDRIGPKKTAVIGMLITMIPLLWGAFGGRSLTELYAIGILLGVAGASFA
VALPMASRWYPPHLQGLAMGIAGAGNSGTLFATLFGPRLAEQFGWHSVMGIALLPLMIVF
ILFIVMAKDSPAQPAPQPLKNYLHVFRQKETWCFCLLYGVTFGGFVGLSSFLAIFFVDQY
QLSKIHAGDFVTICVAAGSFFRPAGGWISDRAGGAKVLAVLFVIAALCMAGVSSLPPLST
VIVLLFIGMMALGMGNGAVFQLVPQHFAKEIGMVTGIVGAAGGIGGFFLPNILGSLKQMT
GTYAIGFISFSCIALLAFVLVLAAGYFWRKSYGTENSPADV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcggaattaaaaacaagcggtcatccgctcactctgctctgttccttctta
tattttgatgtgagttttatgatttgggtaatgctgggggcgctcggcgtttatatttct
caggatttcgggttatcttcttttgaaaaagggtttgtcgtggctctgccgatcttatca
ggatctgtgtttcggatcattttaggtgtgttaacggacaggatcgggccgaagaaaaca
gccgtgatcgggatgctgatcacgatgatcccgctgctttggggggcattcggcggccgt
tctttgactgagctgtatgcgatcggcattctgctgggcgtggcgggcgcaagttttgct
gttgcgcttccgatggcgagccggtggtatccgcctcacttgcaggggcttgcgatgggg
atagcaggtgccggcaacagcggcactttgtttgcgacattgttcggtccccgccttgcg
gaacagtttgggtggcacagtgtaatgggaattgcacttcttccgttgatgatcgttttt
atactgtttatcgtcatggcgaaggactctcctgcacagcccgcaccgcagccgcttaaa
aactaccttcacgttttcaggcagaaggaaacatggtgtttctgtcttttgtacggcgtc
actttcggaggttttgtgggattatcaagttttttggcgatttttttcgttgatcaatat
caattgtcaaaaatccatgccggtgatttcgtcacaatatgtgtcgcagcgggcagtttt
tttcgccctgcaggaggctggatttcagaccgtgcgggaggtgcgaaagttctggctgta
ctgtttgtcatcgcggctctgtgtatggcgggagtcagcagcctgcctccgctttcaacg
gtgatcgttctgctgtttatcggaatgatggcgctcggtatgggcaacggagcggtattt
cagcttgtccctcagcactttgcaaaagaaatcggaatggtgacgggaatcgtcggagca
gccggcggcatagggggttttttccttccgaatattttaggatcattgaagcagatgacg
ggaacgtatgcgatcggttttatctctttctcatgtatcgcattgctcgcatttgtgctt
gttctggccgcaggctatttttggagaaaaagctatggcactgaaaacagtcctgcggat
gtttaa

DBGET integrated database retrieval system