KEGG   Bacillus velezensis UCMB5036: BAM5036_0364Help
Entry
BAM5036_0364      CDS       T02480                                 

Gene name
yclN
Definition
(GenBank) putative iron-siderophore ABC transporter (permease)
  KO
K02015  iron complex transport system permease protein
Organism
baml  Bacillus velezensis UCMB5036
Brite
KEGG Orthology (KO) [BR:baml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:baml02000]
    BAM5036_0364 (yclN)
Transporters [BR:baml02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BAM5036_0364 (yclN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: CCP20424
LinkDB All DBs
Position
405971..406924
Genome map
AA seq 317 aa AA seqDB search
MKLRYLLLLLAVLACTSIFIGVEDLSPLDIFHLNKEQAGTLFDSRLPRLVSIIIAGMSLS
ICGLIMQQISRNKFVSPTTAGTMDWARLGILISLMLFTSASPLVKMSIAFVFALAGNFLF
MKILERIKFNDAIFIPLVGLMLGNIVSSIATFIAYKYDLIQNLSSWLQGDFSLVVKGRYE
LLYLSIPLVIIAYVYADKFTVAGMGESFSVNLGLKYKRVVNIGLIIVSLIASLVILTVGM
LPFLGLIIPNMVSIYKGDNLRSSLPHTALLGAVFVLFCDILGRVIIFPYEISIGLMVGVI
GSGIFLYMLLRRKAYES
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacgttacttacttttgctactggcggttttggcgtgtacttctatatttatc
ggtgtagaagatttgtcgccgctggatatttttcatttaaataaagaacaggcgggtaca
ttgtttgacagccggctgccgcgtttggtgagcattatcatcgccggcatgagcctgagc
atctgcggattaatcatgcagcagatcagccggaataaatttgtatcgccgacgactgcg
ggaacgatggattgggcaaggctcggaatcttgatttcattaatgctttttacgtcagcg
agtccgcttgtgaaaatgtctatcgctttcgttttcgcgttggcgggaaatttccttttc
atgaaaatcctcgagagaatcaagttcaatgatgcgatttttattcctctcgtcggttta
atgcttgggaacatcgtcagctcaatcgccacgtttatcgcatataaatatgacctgatc
caaaacctgtcgtcttggctgcagggagatttctcactggtcgtcaaaggccggtatgag
cttttatatctgagtatcccgctggtgatcatcgcttatgtgtatgcggataaatttacg
gtggcgggaatgggagagagcttttccgtcaatctcggcctgaaatacaaacgcgtcgtt
aatatcggtctgattatcgtgtcgctcatcgcttcactggtgatcctgaccgtcgggatg
ctgccgtttctcggtttgatcattcccaatatggtgtcgatttacaaaggggacaacctg
aggagcagcctgcctcacaccgctctgctgggcgctgtttttgtgctgttttgcgacatt
ttgggaagggtgatcatcttcccgtacgaaatttccatcggcctgatggtcggtgttatc
ggcagcggcatcttcctgtatatgctgttaaggagaaaagcatatgagtcataa

DBGET integrated database retrieval system