KEGG   Bacillus velezensis UCMB5113: BASU_0617Help
Entry
BASU_0617         CDS       T02796                                 

Gene name
ydjO
Definition
(GenBank) Uncharacterized protein ydjO
Organism
bamn  Bacillus velezensis UCMB5113
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YdjO Ogr_Delta
Motif
Other DBs
NCBI-ProteinID: CDG24918
LinkDB All DBs
Position
complement(636463..636672)
Genome map
AA seq 69 aa AA seqDB search
MSYYNKRNQEPLPKEDVSTWECTKEDCIGWSRKNFAGSDTPTCPLCGSKMIDGVRSLVNL
QNNNQTASS
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactacaacaaacgtaatcaggaaccgctgcctaaagaagatgtcagtacgtgg
gaatgcacaaaagaggactgtatcggctggagcagaaagaattttgccggcagtgatacc
ccgacttgccccctttgcggcagtaaaatgatcgacggcgtccgttcgttggtaaatctc
caaaacaataaccaaacggcatcaagttag

DBGET integrated database retrieval system