KEGG   Bacillus velezensis UCMB5113: BASU_1792Help
Entry
BASU_1792         CDS       T02796                                 

Gene name
yngHA
Definition
(GenBank) biotin carboxylase/methylcrotonoyl-CoA carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn00061  Fatty acid biosynthesis
bamn00620  Pyruvate metabolism
bamn00640  Propanoate metabolism
bamn01100  Metabolic pathways
bamn01110  Biosynthesis of secondary metabolites
bamn01120  Microbial metabolism in diverse environments
bamn01130  Biosynthesis of antibiotics
bamn01200  Carbon metabolism
bamn01212  Fatty acid metabolism
Module
bamn_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BASU_1792 (yngHA)
   00640 Propanoate metabolism
    BASU_1792 (yngHA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BASU_1792 (yngHA)
Enzymes [BR:bamn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BASU_1792 (yngHA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BASU_1792 (yngHA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CDG26085
LinkDB All DBs
Position
complement(1927808..1929157)
Genome map
AA seq 449 aa AA seqDB search
MFKKVLIANRGEIALRIIRTCKRLGIPSAAVYSEADRDALHVKAADEAYPIGKSRVNESY
LHIDRIIEAAKSAGANAIHPGYGLLSENSLFAERCRKEQITFIGPPGDIIAKMGSKIEAR
KTMQKAKVPIVPGVSEPLPDVHSALAEARAIGFPVMLKASAGGGGIGMQIVHSEEELAKA
FEGNQKRAASFFGDGAMYMEKVIENARHIEIQILADSFGNTVHLFERDCSVQRRHQKVIE
EAPSPFVDDELRQRLGETAVKAAKSIGYQNAGTIEFLVDQKKQIYFLEMNTRLQVEHPVT
EEITGLDLVEEQLKIAAGQALPFSQKDINHRGHAIEVRIYAEDPVTFYPSPGTISSFSVL
RHPSVRHECAVEKGSVISPFYDPMIAKMVVTANTRKQAIEQLKTALGEYHVEGIKTNIPL
LTKIAHSEGFEKGEATTGFLQTMNEGASK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaaaagtcctgattgccaacagaggagaaatcgccttacgaattatccgcacc
tgcaaacgtctcggcatcccctcggcagctgtgtattcagaagccgaccgggacgcgctg
catgtaaaagcggctgatgaggcctatccgatcggtaaatcgagagtaaatgaaagctat
ttacatatcgacagaatcatagaagccgccaaatccgccggagcgaacgccattcatccg
ggctacgggcttctgtcagaaaacagcctgttcgccgaacgctgccggaaggaacaaatc
acatttatcggtccgcccggtgatatcatcgccaagatgggcagcaagattgaagcccga
aaaacgatgcaaaaagcaaaggtcccgatcgttcccggtgtttcagagccattgcccgat
gttcactccgccttagccgaagcccgtgccatcggttttccggtcatgctgaaagcgtcc
gcaggaggaggcggaatcggcatgcagatcgtacattcagaagaagagctggccaaagcg
ttcgaaggaaatcaaaagcgggccgcgtccttttttggagacggcgcaatgtacatggaa
aaggtcattgaaaatgcccgtcatattgaaattcagatactcgcagattctttcggcaac
accgttcatctgtttgaacgtgactgttcagtccaaaggcgccaccaaaaagtgatagaa
gaagcgccgtcgccgtttgttgacgatgaattaagacaaagactcggtgaaaccgccgtt
aaagccgcaaaatcgatcggctaccaaaatgcaggcacaatagaatttctcgtcgaccaa
aagaaacaaatctattttttagagatgaacaccagactgcaggtggagcatccggtgaca
gaagaaattacaggactggatcttgtggaagaacagctgaaaattgccgctgggcaggcg
ctgcctttctcgcagaaagatatcaaccaccgcggtcatgcgatagaagtgcggatttat
gcggaagatccggtcaccttttacccgtctcccggtaccatctcgtctttttccgtttta
agacacccgtcagtgcgacacgaatgcgccgtcgaaaagggaagcgtcatttctccgttt
tacgatccgatgattgccaaaatggtcgtcacggcgaatacgagaaaacaagccattgaa
caactgaaaaccgcccttggcgaatatcatgtagaagggattaaaaccaacattccgctg
ctgacaaaaattgcccattcagaagggtttgaaaagggcgaggcaacaaccggtttttta
caaacaatgaacgagggggcgtcaaaatga

DBGET integrated database retrieval system