KEGG   Bacillus velezensis UCMB5113: BASU_2571Help
Entry
BASU_2571         CDS       T02796                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn00010  Glycolysis / Gluconeogenesis
bamn00030  Pentose phosphate pathway
bamn00051  Fructose and mannose metabolism
bamn00052  Galactose metabolism
bamn00680  Methane metabolism
bamn01100  Metabolic pathways
bamn01110  Biosynthesis of secondary metabolites
bamn01120  Microbial metabolism in diverse environments
bamn01130  Biosynthesis of antibiotics
bamn01200  Carbon metabolism
bamn01230  Biosynthesis of amino acids
bamn03018  RNA degradation
Module
bamn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bamn_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BASU_2571 (pfkA)
   00030 Pentose phosphate pathway
    BASU_2571 (pfkA)
   00051 Fructose and mannose metabolism
    BASU_2571 (pfkA)
   00052 Galactose metabolism
    BASU_2571 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    BASU_2571 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BASU_2571 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bamn01009]
    BASU_2571 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bamn03019]
    BASU_2571 (pfkA)
Enzymes [BR:bamn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BASU_2571 (pfkA)
Protein phosphatases and associated proteins [BR:bamn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BASU_2571 (pfkA)
Messenger RNA biogenesis [BR:bamn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BASU_2571 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CDG26861
LinkDB All DBs
Position
complement(2763149..2764108)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMQEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLKGKGGRCVGIQNNKLVDHDIIEIL
ESKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggcggggattccccgggtatgaacgctgcggtg
cgcgcggttgtgcggaaagctatctaccacgacgtcgaagtgtacggaatttataacggt
tattcaggattaatcagcggaaaaatagagaaactggagcttggttcggtcggtgacatc
atccaccgcggcggaacaaagctgtatacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcattgaaggtcttgtcgtcatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccgtgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaacaccgtaattgatgcgattgataaaatccgtgacaccgctacgtctcat
gagcgtacatacgttattgaagtgatggggcgccatgcgggcgacattgctttatgggca
ggtcttgcaggcggagcggaatcaattttaattcctgaagcggactacgatatgcaggaa
attatcggccgtttgaagagagggcacgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagaaacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttaaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gaatcaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system