KEGG   Bacillus velezensis UCMB5113: BASU_2917Help
Entry
BASU_2917         CDS       T02796                                 

Gene name
yusN
Definition
(GenBank) Uncharacterized protein coat-F domain containing protein
Organism
bamn  Bacillus velezensis UCMB5113
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_F Autoind_synth Nore1-SARAH BRCA-2_OB1
Motif
Other DBs
NCBI-ProteinID: CDG27199
LinkDB All DBs
Position
3107690..3108022
Genome map
AA seq 110 aa AA seqDB search
MEQQNQKITNPQTPVPNTAQMNDRDLVNELLTTEKYITASYCTALHEFSHESLYQDIQAI
FDESQKAQRRLYDVMFQNGWYSIEAADTQKLQQSYQKFRQTIQQQSPYQQ
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcaaaaccaaaaaatcacgaatccgcaaacgcccgtgcccaatacggcgcaa
atgaatgacagagacttggtgaatgagctgctgacgacggaaaaatacatcacggcttca
tattgcacagccctgcacgagttcagccacgagtctctttaccaagatattcaggcgatt
ttcgatgagtcacaaaaagcgcaaagaagattatacgatgtgatgtttcaaaatggctgg
tattccattgaagcagccgatactcaaaagcttcagcaatcgtatcagaagttccggcag
accattcagcagcagtctccctaccagcagtaa

DBGET integrated database retrieval system