KEGG   Bacillus velezensis UCMB5113: BASU_3649Help
Entry
BASU_3649         CDS       T02796                                 

Gene name
walR
Definition
(GenBank) two-component response regulator [YycF]
  KO
K07668  two-component system, OmpR family, response regulator VicR
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BASU_3649 (walR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bamn02022]
    BASU_3649 (walR)
Two-component system [BR:bamn02022]
 OmpR family
  VicK-VicR (cell wall metabolism)
   BASU_3649 (walR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: CDG27924
LinkDB All DBs
Position
complement(3826695..3827405)
Genome map
AA seq 236 aa AA seqDB search
MMDKKILVVDDEKPIADILEFNLRKEGYDVHCAYDGNEAVEMVEELQPDLILLDIMLPNK
DGVEVCREVRKKYDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRR
QLTVAPAEEESASNDIHIGSLVIFPDAYVVSKREETIELTHREFELLHYLAKHIGQVMTR
EHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatggataagaaaatccttgtagtcgatgatgaaaaaccgattgcagatatattagag
tttaatttaagaaaagaaggctatgacgtgcattgtgcgtacgacggaaacgaagccgtg
gaaatggtggaggagcttcagcctgatttaattcttttagatattatgcttccgaataaa
gacggagttgaagtgtgccgggaagtccggaaaaaatatgatatgccgattattatgctg
acggcaaaagactcggagattgacaaggtcatcgggcttgaaatcggagcggatgactat
gtcacgaagcctttcagcacgcgtgagcttctggcccgcgtcaaagcgaacctgcgccgc
cagcttacggttgcgccggctgaggaagaatcagcttctaatgacattcatatcggttct
ctcgtcatcttccctgacgcttatgtcgtatcaaaaagagaagaaacgatcgagctgact
catcgtgagtttgaattgcttcattacttagccaaacatatcggacaggttatgacgcgt
gagcatctgctgcagactgtgtggggctatgactatttcggtgatgtgagaacggtggat
gtaacagtgcgccgtctccgtgagaaaatcgaggataatccgagccatccgaactggatc
gtcacaagacggggtgtcggttattacttgagaaaccctgaacaggactaa

DBGET integrated database retrieval system