KEGG   Bacillus velezensis AS43.3: B938_00370Help
Entry
B938_00370        CDS       T02382                                 

Gene name
hslO
Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bamp  Bacillus velezensis AS43.3
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bamp03110]
    B938_00370 (hslO)
Chaperones and folding catalysts [BR:bamp03110]
 Heat shock proteins
  HSP33
   B938_00370 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AFZ89119
LinkDB All DBs
Position
80525..81400
Genome map
AA seq 291 aa AA seqDB search
MDYLIKAIAYDGKVRAYAARTTDMVNEAQRRHDTWPTASAAIGRTMTASLMLGAMLKGED
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPHVHFDLNEQGKLDVRRAVGTDGTLSVVK
DLGLRDYFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLL
PGTDEETISTIEKQLSQIEPISKLIQKGLTPEEILEEVLGQKPDVLETMPVKFHCSCSKD
RFETAILGLGKKEIQDMIEEDGKAEAVCHFCNEKYLFTKEELEELRDETTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttaattaaagcaattgcatatgacggtaaagtgcgggcttatgcagccaga
acgacagatatggtaaatgaagcgcaaagaaggcatgacacgtggccgacggcatcagcc
gcaatcggccggacgatgacagcttctctgatgctaggcgcgatgcttaagggtgaagat
aagctgacagtcaaaatagaaggcggcggcccgatcggagccattgtcgcagatgcgaac
gcaaagggtgaggtaagagcatacgtgtcaaacccgcacgttcattttgatctcaatgaa
caagggaaactggatgtcagacgggcggtcggaactgacggaacactcagtgtcgtaaaa
gatttgggcttgcgtgattattttacgggacaagtagagattgtctcgggtgaactcggt
gacgacttcacatattatcttgtttcttctgaacaagtcccttcatctgtcggcgtaggt
gttctggtaaatcctgataacacgattctcgctgcgggcgggttcatcattcagcttctt
ccggggactgatgaagaaaccatttcaacaattgaaaagcaattatctcaaattgaaccg
atttcaaaattgattcaaaaaggcctgacaccggaagaaatcttagaagaagttctgggt
caaaaaccggacgttctcgaaacaatgccggtcaaatttcactgttcttgttcaaaagat
cgattcgaaacggccattttaggactaggcaaaaaagaaatacaagatatgatagaagaa
gacggaaaagccgaagcggtttgccatttttgtaatgagaaatatttatttacaaaagaa
gaactggaagagcttcgtgacgaaacaacccgctag

DBGET integrated database retrieval system