KEGG   Bacillus velezensis AS43.3: B938_01530Help
Entry
B938_01530        CDS       T02382                                 

Definition
(GenBank) Nitrate transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    B938_01530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bamp02000]
    B938_01530
Transporters [BR:bamp02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    B938_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 LacY_symp
Motif
Other DBs
NCBI-ProteinID: AFZ89342
LinkDB All DBs
Position
324657..325862
Genome map
AA seq 401 aa AA seqDB search
MKLSELKTSGHPLTLLCSFLYFDVSFMIWVMLGALGVYISQDFGLSSFEKGFVVALPILS
GSVFRIILGVLTDRIGPKKTAVIGMLITMIPLLWGAFGGRSLTELYAIGILLGVAGASFA
VALPMASRWYPPHLQGLAMGIAGAGNSGTLFATLFGPRLAEQFGWHSVMGIALLPLMIVF
ILFIVMAKDSPAQPAPQPLKNYLHVFRQKETWCFCLLYGVTFGGFVGLSSFLAIFFVDQY
QLSKIHAGDFVTICVAAGSFFRPAGGWISDRAGGAKVLAVLFVIAALCMAGVSSLPPLST
VIVLLFIGMMALGMGNGAVFQLVPQHFAKEIGMVTGIVGAAGGIGGFFLPNILGSLKQMT
GTYAIGFISFSCITLLAFVLVLAAGYFWRKSYGTENSPADV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcggaattaaaaacaagcggtcatccgctcactctgctctgttccttctta
tattttgatgtgagttttatgatttgggtaatgctgggggcgctcggcgtttatatttct
caggatttcgggttatcttcttttgaaaaagggtttgtcgtggctctgccgatcttatca
ggatctgtgtttcggatcattttaggtgtgttaacggacaggatcgggccgaagaaaaca
gccgtgatcgggatgctgatcacgatgatcccgctgctttggggggcattcggcggccgt
tctttgactgagctgtatgcgatcggcattctgctgggcgtagcgggcgcaagttttgct
gttgcgcttccgatggcgagccggtggtatccgcctcacttgcaggggcttgcaatgggg
atagcaggtgccggcaacagcggcactttgtttgcgacattgttcggtccccgccttgcg
gaacagtttgggtggcacagtgtaatgggaattgcgcttcttccgttgatgatcgttttt
atactgtttatcgtcatggcgaaggactctcctgcacagcccgcaccgcagccgcttaaa
aactaccttcacgtgttcaggcagaaggaaacatggtgtttctgtcttctgtacggcgtc
actttcggaggttttgtgggattatcaagttttttggcgatttttttcgttgatcaatat
caattgtcaaaaatccatgccggtgatttcgtcacaatatgtgtcgcagcgggcagtttt
tttcgccctgcaggaggctggatttcagaccgggcgggaggtgcgaaagttctggctgta
ctgtttgtcatcgcggctctgtgtatggcgggagtcagcagcctgcctccgctttcaacg
gtgatcgttctgctgtttatcggaatgatggcgctcggtatgggcaacggagcggtattt
cagcttgtccctcagcactttgcaaaagaaatcggaatggtgacgggaattgtcggagcg
gccggcggcataggaggttttttccttccgaatattttaggatcattgaagcagatgacg
ggaacttatgcgatcggttttatctctttctcatgtatcacattgctcgcatttgtgctt
gttctggccgcaggctatttttggagaaaaagctatggcactgaaaacagtcctgcggat
gtttaa

DBGET integrated database retrieval system