KEGG   Bacillus velezensis AS43.3: B938_08100Help
Entry
B938_08100        CDS       T02382                                 

Definition
(GenBank) PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bamp  Bacillus velezensis AS43.3
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bamp01001]
    B938_08100
Enzymes [BR:bamp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     B938_08100
Protein kinases [BR:bamp01001]
 Serine/threonine kinases: Other
  Bacterial family
   B938_08100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Kdo APH RIO1 Haspin_kinase Pkinase_fungal Seadorna_VP7 PBP_N Trp_oprn_chp FixH DUF4366
Motif
Other DBs
NCBI-ProteinID: AFZ90642
LinkDB All DBs
Position
1626052..1627995
Genome map
AA seq 647 aa AA seqDB search
MLTGKRISGRYHILRPIGGGGMANVFLAEDIILEREVAIKILRFDFVNDIDFIRRFRREA
QSASSLDHPNIVSIYDIGEEGDIYYIVMEYVEGMTLKEYINAHGPLHPKEALSVMEQIVS
AIAHAHQNHIVHRDIKPHNILIDHLGHIKVTDFGIATALTSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGKIPFDGESAVSIALKHLQTETPSARKWNPSIPQS
VENIILKATAKDPFHRYESAEDMEADIRTAFDAGRLNEQKFSVQDDEEMTKAIPVITDGA
KAAPQAETPGETDDKEQQPAKKKKRKWPWVLLAVCFIFIMAAVLAVTVFPSLFMPKDVSV
PDVRGMKYEKAEALLEKNGLRADPDITDIEDEKIEEELMVKTDPKAGSTVKEGSSVKLYK
SIGKPKTQLIDVKGRQIGDAKKALKEKGFKHVNVKEENDDSEAGTVIDQNPSAGTDMVAS
DDEVNLTVSLGPADVTLRDLKTYSKEAASGYLEDNGLQLVEKQAHSDDVPEGQVMKQEPA
AGTAVKPGSNVEVTFSLGPEEKPAKTVKEKISIPYEPEHEGDELEVQIAIDDKDHSISDT
YDSFKIKEPTEKTIELKIDQGQKGYYQVMVDHKVVSYKTIEYPKDND
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccggcaagcggatcagcgggcgttatcatatcctccggcctattggcggcggc
ggaatggcaaacgtttttttagctgaggacatcattctcgaacgtgaagtcgcaattaaa
attctgcggtttgactttgtgaatgacattgattttatcaggcgtttcagaagagaagca
cagtcggcatcaagcctcgatcatccgaatatcgtcagtatttacgatatcggggaggaa
ggcgatatttattacattgtcatggaatatgtggaaggcatgacattaaaggaatacata
aacgcacacggaccgcttcatccgaaagaagcgctgtccgttatggagcagatcgtctcg
gccatcgcccatgcccatcaaaaccatatcgtgcaccgggatattaaaccgcacaatata
ttgatagatcatttagggcatatcaaggtgacggatttcggcatcgccacagcgcttacg
tctacgacaatcacacatacgaattctgtgctgggctcggttcattatttgtctccggag
caggcgagaggcggtctggcaacgaaaaaatcagatatttacgcgctcggcatcgtgctg
tttgagcttttaacaggtaaaatcccttttgacggagaatcagccgtcagtatagcgcta
aagcatctgcaaacagaaacgccttccgccagaaagtggaacccttccattccgcagagc
gtcgaaaacattattttaaaggcaaccgctaaagacccgtttcaccgctatgaaagcgcc
gaggacatggaagcggacatcagaacggcttttgacgccggcaggctgaatgaacaaaaa
ttttccgtgcaggatgatgaggaaatgacaaaagccattcccgttattactgacggcgca
aaagccgcgcctcaggcggaaacgccgggggagacggatgataaggaacagcagcccgcc
aaaaagaaaaaacggaaatggccgtgggttttgctggccgtctgtttcattttcattatg
gcggctgttcttgcggtcaccgtgttcccgtctttgtttatgcctaaagatgtaagcgtc
cccgacgtacggggcatgaagtacgaaaaagcggaagccctgcttgaaaagaacgggctc
cgggcggatcctgatataacggatattgaagatgaaaaaatagaagaggaattaatggtc
aaaacggacccaaaagcggggtctaccgttaaagaaggctcttctgtaaaactgtacaaa
agcatcggaaaaccgaaaacccagctgatcgacgtgaaagggcggcagatcggcgacgca
aaaaaagcgctgaaggaaaaaggcttcaaacatgtcaatgtcaaagaagagaacgatgac
agcgaggccggcactgtaattgatcagaacccgtcagccggcaccgatatggtcgcaagc
gacgatgaagtcaatctaacggtcagcctcggccccgcggatgttacgctgagggactta
aagacttacagcaaagaagcggcttcagggtatcttgaagataacggcctgcagcttgtt
gaaaaacaagcccattcagatgacgtgccggaaggacaagtcatgaagcaagagccggca
gccggcactgcggttaagccgggaagtaatgttgaagtgacgttctcgctcggacctgaa
gaaaaaccggcgaaaacggtaaaagaaaaaatcagcattccttacgaacccgaacatgaa
ggggacgagcttgaagtgcaaatcgccatcgatgataaggaccacagcatctctgatacg
tatgactcttttaaaataaaagagccgactgaaaaaacaattgaactgaagattgatcag
ggacagaaggggtattatcaagtgatggtcgatcataaagtcgtcagctacaaaacgatt
gaatacccgaaagataatgactga

DBGET integrated database retrieval system