KEGG   Bacillus velezensis AS43.3: B938_12055Help
Entry
B938_12055        CDS       T02382                                 

Definition
(GenBank) Fe-Mn family superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bamp  Bacillus velezensis AS43.3
Brite
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B938_12055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFZ91425
LinkDB All DBs
Position
complement(2511990..2512595)
Genome map
AA seq 201 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL
NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFAA
AAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVARLYSEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattgccttacgcttatgatgctttagaacctcatatcgat
aaggaaacgatgacgattcaccatacgaagcaccataacacatacgtgacaaacctcaac
aaagcgatcgaaggatcagcgcttgcagagaaatctgtagatgagcttgttgctgatttg
aacgcagtgccggaggacatccgcacggcagtccgcaacaatggcggcggacatgcaaac
cactctttattctggactcttttatctccgaacggcggaggcgaaccgactggtgagctt
gctgaagagatcaaaagcacgttcggaagcttcgatcaatttaaagaaaaattcgccgcg
gcagctgcaggccgtttcggttcaggctgggcttggctcgttgtaaacaacggcaaactt
gaaattacaagcacgccaaaccaagattcaccgctttcagaaggtaaaacacctgttctc
ggtcttgatgtttgggagcacgcgtactatctgaactaccaaaaccgccgtcctgattac
atttcagctttctggaatgttgtgaactgggatgaagttgcccgtctttacagcgaagca
aaataa

DBGET integrated database retrieval system