KEGG   Bacillus velezensis AS43.3: B938_12815Help
Entry
B938_12815        CDS       T02382                                 

Definition
(GenBank) hypothetical protein
Organism
bamp  Bacillus velezensis AS43.3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF421 FtsH_ext
Motif
Other DBs
NCBI-ProteinID: AFZ91575
LinkDB All DBs
Position
complement(2655787..2656443)
Genome map
AA seq 218 aa AA seqDB search
MEDIFIITFRTIVLYFIILVIFRLMGKREIGELSILDLVVSIMIAEIAVLAIENVKDKLL
HTIVPIVVLMIIQVSLAFISLKSQKIRQLLDGKPTIIIKQGKIDERAMRSQRYNFDDLLM
QLRENNIDRISDVSYAILESSGKLSIVKKKNNKDKQMETSLIVDGVIQNEHLDRIGKDKH
WLEKNLAKRGYRDLSVISFCTFTDGAFFIDLKDEKGEP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggaagatattttcattattacgtttcgtacgattgtgctttattttatcattcttgtg
attttcagactgatgggaaaacgggaaatcggagaactgagcattttagaccttgtcgtc
tccattatgattgccgagattgccgtattggcaattgaaaatgtaaaagataagcttttg
catacgattgtgccgattgtcgttttaatgattattcaagtaagccttgcttttatttcg
ctcaaaagccaaaaaatacggcagctgcttgacggaaaacccaccattattataaaacag
ggaaaaattgatgaacgggcgatgagatcgcagcgctacaattttgacgatcttcttatg
cagctgagggagaataacatcgatagaatctctgacgtgtcatatgccattttggagtct
tcaggcaaactgtcgatcgtcaaaaagaaaaacaataaggataagcagatggaaacatcg
cttatcgttgacggggtcattcagaacgagcatctggacagaatcgggaaagataaacac
tggctcgaaaaaaatttagcaaaaagaggatatcgcgatctttcggttatatcattctgc
acgtttacggacggcgctttttttattgatcttaaagatgaaaaaggggagccatga

DBGET integrated database retrieval system