KEGG   Bacillus velezensis AS43.3: B938_13535Help
Entry
B938_13535        CDS       T02382                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00020  Citrate cycle (TCA cycle)
bamp00480  Glutathione metabolism
bamp01100  Metabolic pathways
bamp01110  Biosynthesis of secondary metabolites
bamp01120  Microbial metabolism in diverse environments
bamp01130  Biosynthesis of antibiotics
bamp01200  Carbon metabolism
bamp01210  2-Oxocarboxylic acid metabolism
bamp01230  Biosynthesis of amino acids
Module
bamp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B938_13535
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B938_13535
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B938_13535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFZ91717
LinkDB All DBs
Position
complement(2796122..2797393)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSDAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLIIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
attatcccgtttattgaaggcgacggcacaggccctgatatttggaacgccgcttctaaa
gtattggaagccgctgttgaaaaagcatataaaggcgagaaaaaaatcacatggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgagtggcttcctgccgaaacgctg
gaagacatcagagagtacttcatcgccatcaaaggtcctctgacgacaccggtcggcggc
ggtatccgttctctgaacgtggcgctgagacaggagcttgatttgtttacgtgcctgcgc
cctgtcagatatttcacgggagtgccttctccggtcaaacgacctgaagatacggatatg
gtcattttccgcgagaatacggaagatatttacgccggaattgagtatgcgaaaggttct
gaagaggttgaaaagctgatcagcttcctgcaaaatgaaatgggtgttaacaaaatccgt
ttccctgaaacgtcaggaatcggcatcaaacctgtttctgaagaaggcacaagccgctta
gtcagagctgccattgagtatgcgatcgaaaacggccgtaagtctgtcacgcttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctacgagcttgcc
gaaagagaatacggagataaagtattcacttgggctgaatatgaccgcattgtcgaaaaa
gacggaaaagaagcggctgataaagcgcagagcgatgcggaagcggcaggaaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttaacccgtccgagcgaattc
gacgtcgtggcgacaatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacagggcatgcgatt
ttcgaagcgactcacggaacggctcctaaatatgccggccttgacaaagtcaacccgtca
tccgtcatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggctgctgac
ttgatcattaaatctatggaaaaaacgattgcttcaaaagtagtaacgtacgattttgct
agattaatggacggcgcaactgaagtgaaatgttcagagtttggtgaagagctaattaaa
aacatggactga

DBGET integrated database retrieval system