KEGG   Bacillus velezensis AS43.3: B938_15330Help
Entry
B938_15330        CDS       T02382                                 

Definition
(GenBank) hypothetical protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00071  Fatty acid degradation
bamp00362  Benzoate degradation
bamp00650  Butanoate metabolism
bamp01100  Metabolic pathways
bamp01120  Microbial metabolism in diverse environments
bamp01200  Carbon metabolism
bamp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B938_15330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B938_15330
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B938_15330
Enzymes [BR:bamp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B938_15330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AFZ92074
LinkDB All DBs
Position
complement(3143700..3146069)
Genome map
AA seq 789 aa AA seqDB search
MHKFIKKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNELTKDEMKKGLTLESPEVRSR
LSRSAMQKLLKQKPAPLTSAANLDYITAGNLEDDAAQLKDADWIIEVVVENLDVKKQIFS
LVDEYRKPGSIVSSNTSGISVTKMAEGRSADFKAHFLGTHFFNPARYLKLLEIIPIQETD
PDVLEFMTSFAENTLGKGVVIAKDTPNFIANRIGTYGLLVTVREMLSSGCRIGEVDTVTG
PLIGRPKSATFRTLDVVGLDTFAHVAKNVYDKADGAEKDMFKLPEFMNDMLKNNWLGSKS
GQGFYKKEGKTIYELDPLTMTYGERSKMKTPALEAAKQAKGAKGKMKALIYSDDRAGRLL
WNITSQTLLYSARLLGEIADDIKAIDDAMKWGFGWELGPFEMWDAIGVRKSAERLEEEGA
ALPGWVKEMLDQGHETFYMKENGTPFYYSDGQYRAVKENPKRISLQTLKETKGVITKNSG
ASLIDLGDDVALLEFHTKSNAIGLDIIQMIDNALEETERNYKGLVIGNQGRHFCAGANLA
MILMEAQDDNFMEVDFVIRRFQQTMLNIKYSAKPVVAAPFGMTLGGGTEVCLPAARVQAA
SESYMGLVETGVGLIPGGGGNKELYMNYLDGGSELMDAAIKTFETIALAKVSGSAHEARD
MKILSAADRISMNQDHLLHDAKQLAASLYDSGYRPPARKKVKVTGETGCAALLLGADQMR
RSGYLSDHDMKIAKKLAHVIAGGRVPFGTEVSEEYLLEIEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtttataaagaaagcagccgttctcggatcaggcgtcatggggtccggaatt
gccgcgcacttggctaacatcggaattcccgtcctgctgcttgatattgtgccaaacgag
ctgacaaaggatgagatgaaaaaagggctgacattagaaagcccggaggtccgcagcaga
ctgagccgatcggccatgcaaaagctgctgaagcaaaaaccggcgccgctgacttcggct
gccaatctcgactatataacggcggggaatttggaagatgacgcagctcaattgaaggat
gctgattggattattgaagtcgtcgtcgaaaatcttgacgtaaaaaaacagattttctca
ctcgttgatgaataccggaaaccgggaagcatcgtgtcgagcaatacgtccggtatctcc
gtcacaaaaatggcggaaggccgatctgccgattttaaagctcatttcttaggaacccat
ttctttaatccggcccgctacttaaagcttctggaaatcattccgattcaggaaacagat
cctgacgtgctggagtttatgacttcatttgcagaaaacacgctcgggaaaggggtcgtc
atcgcaaaagacacgcctaactttatcgccaaccgcatcggtacgtacggcctgctggtc
acggtaagagaaatgctttcttccggctgccgcatcggcgaggtggacacggtgaccggg
cctttgatcggcagaccgaaaagcgcgaccttcagaacccttgacgttgtggggcttgat
actttcgcccatgtggcaaaaaatgtgtatgataaagccgacggcgctgaaaaagacatg
tttaagcttcctgaatttatgaatgacatgctgaaaaacaattggctgggcagcaaatca
ggccaaggtttttacaaaaaagaaggtaaaacaatatatgaactcgacccgctgaccatg
acatacggtgagcgctcgaaaatgaagacgcccgctttagaagccgccaaacaggcaaag
ggtgccaaaggcaaaatgaaagcgcttatatactctgatgaccgcgccgggcgcctgctt
tggaatattacatcgcaaacactcttatactcagcccggcttttaggtgagatcgctgat
gatatcaaagcaattgatgacgccatgaaatggggcttcggatgggagctcggaccgttt
gagatgtgggatgccatcggcgtcagaaaatcagcggagcggctcgaagaagaaggcgca
gcactccccggctgggtgaaagaaatgcttgatcagggccatgaaacattttatatgaag
gaaaacggaacaccattttactattcagacggccaatacagggctgtgaaagaaaatccg
aaacggatcagcctgcaaacgttaaaagaaacaaaaggcgttatcactaaaaacagcgga
gcaagtctgattgatctcggcgatgatgtcgcgctgctggaatttcatacgaaaagcaac
gcgatcggcttagacattattcagatgattgacaatgcgcttgaggaaacggagcggaat
tataaaggtcttgtcatcggtaaccaaggcagacatttctgcgcgggggcaaaccttgcg
atgattttgatggaagctcaggatgataacttcatggaagtcgattttgtcatccgccgt
tttcagcagacgatgctgaacatcaaatacagcgctaaacccgttgtcgcggcgccattt
gggatgacactcggcggcggcacggaagtctgtctcccggcggcacgcgttcaggcggcg
agcgaatcgtatatgggtcttgttgaaaccggcgtcggccttattccgggcggcggagga
aacaaagagctgtacatgaattatttggacggcggaagtgaactgatggacgcagcgatt
aaaaccttcgaaacaatcgcgcttgccaaagtgtccggttcggcacacgaagcccgtgat
atgaagattttgtccgcggcagaccgtatcagcatgaatcaggatcacctgctgcacgat
gcgaaacagctggctgcttccttatatgacagcggataccgcccgcctgcccgcaaaaaa
gtgaaagtcaccggggaaaccggatgtgcggcattactgctcggagcagaccaaatgaga
cggtcgggttatttatccgatcacgatatgaagattgcgaagaagctggcccatgtcatt
gccggcggaagagtcccgttcggcacggaggtttcagaagaatatttactcgagattgaa
agagaagcctttttaagcctcgctggcgaggcgaaatctcaagcgagaatgcagcatatg
ctcgtcaaaggcaaacctttacggaactag

DBGET integrated database retrieval system