KEGG   Bacillus velezensis AS43.3: B938_17090Help
Entry
B938_17090        CDS       T02382                                 

Definition
(GenBank) hypothetical protein
Organism
bamp  Bacillus velezensis AS43.3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4181 Gaa1
Motif
Other DBs
NCBI-ProteinID: AFZ92420
LinkDB All DBs
Position
3487396..3487638
Genome map
AA seq 80 aa AA seqDB search
MDFIQLLIFSAVFILLSLIFQVFAVKVLNLPKPVKKQKPINGTHRLIEITLLITGIAAVN
FSMKCTYLRELFSCYFAAAA
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggatttcattcagttactgattttttcagccgtatttattttgctcagccttatattt
caagtatttgccgtcaaagttctcaatttgccaaagcctgttaaaaagcagaagccgata
aacggcacacatcgattaatcgaaatcacactgcttattacgggcatcgcagcggtgaat
ttttcaatgaaatgtacgtatttgcgggagttgttttcatgctattttgctgcagcggca
taa

DBGET integrated database retrieval system