KEGG   Bacillus velezensis AS43.3: B938_17900
Entry
B938_17900        CDS       T02382                                 

Gene name
bacF
Definition
(GenBank) transaminase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00998  Biosynthesis of various secondary metabolites - part 2
bamp01100  Metabolic pathways
bamp01110  Biosynthesis of secondary metabolites
Module
bamp_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    B938_17900 (bacF)
Enzymes [BR:bamp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     B938_17900 (bacF)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-ProteinID: AFZ92582
LinkDB
Position
complement(3629032..3630231)
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKEMEKTGAQIINLGQGNPDLPTPPHIVETLREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLHPENGYLPDFERIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQAKEAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAAASALSGNPEHTERLKRTYKE
RIDFFTALCEKELGWSIEKPKGTFYVWAEIPNEFESSHQFSDYLLEHAHVVVTPGEIFGS
GGKRYVRISMVAKQGDLREFVLRIQKLGLSFPSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgacgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagatggagaaaacgggagcccagattattaacctcgggcagggg
aatcccgatctccccacaccgccgcatatcgttgaaactttgcgggaggctgcgctgaat
ccttcgtatcacggatacggcccgttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagagtacggggtatcggtcaatccggagacagaagtcgcgctgttc
ggcggagggaaagctggtttgtacgttttgacgcaatgcctgctgaatcccggcgatatc
gccttagtcccgaaccccggctaccctgagtatttatcgggcattacaatggccagagcg
gagctgcatgagatgccgcttcatccggaaaacggctatttgccggattttgagcggatt
gatcccgccgtcctgaaaaaagccaagctgatgtttttgaattacccgaataacccgacg
ggcgcgactgcggatcaggcgttttatgaaaaagcggcagcgtttgcaaaaaaacatgac
atccaccttattcacgattttgcatacggcgcgttcgaatttgatcagaatccggccagc
tttcttcaggcgaaagaagcgaaaacggtcggcgcggagctttattcattttcgaaaacc
ttcaatatggcaggctggagaatggcatttgccgtggggaatgagaaaatcattcaggcg
gtcaatgagtttcaggatcacgtcttcgtcggcatgttcggcggtcttcagcaggcggca
gcgtcggcgctgtcaggaaatcctgagcataccgagcgtctgaagcgcacatataaagaa
cggattgactttttcacggcgttatgtgaaaaggaattaggctggagcattgaaaaaccg
aaagggactttttatgtctgggctgaaattccgaatgaattcgagtcttcacaccagttt
tcggactatctgctggagcatgcccatgttgtcgtgacgcccggcgagattttcggcagc
ggcggaaagcgttatgtcagaatatcaatggtggccaagcagggcgatttgagggaattc
gtgctgcggattcaaaagctcggtttgtcctttccttcattacaagaaacatcccgctga

DBGET integrated database retrieval system