KEGG   Bacillus velezensis AS43.3: B938_18425Help
Entry
B938_18425        CDS       T02382                                 

Definition
(GenBank) hypothetical protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
bamp  Bacillus velezensis AS43.3
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B938_18425
Enzymes [BR:bamp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     B938_18425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin DUF4630
Motif
Other DBs
NCBI-ProteinID: AFZ92683
LinkDB All DBs
Position
complement(3729930..3730760)
Genome map
AA seq 276 aa AA seqDB search
MNIMDWTEQDVKDTLPKREADSHKGTFGTALLLAGSEDMPGAALLAGLGAMRSGVGKLVI
GTSEGVIPLIVPVLPEATYWRDGWKKAAAGQPGETIRAAAIGPGLPQTDEVQQAADQLLS
ADYPVILDAGAITKRTYPKRKAPVILTPHPGEFSRMTGLPIQEIQQNRAGYAAEWAERLH
VTIVLKGNETIIAFPDGECRRNTTGNGALAKGGTGDTLTGMILGMLCCHQDPKHAVLNAV
RLHGECAELWTKERSAHTLLAHELSELLPRVWKEYE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaatataatggattggacggaacaggatgtgaaagatacgctgccgaagcgggaagca
gacagccataaggggacgttcgggacggcgttattgctggccggcagcgaagacatgccg
ggagccgcccttctggccggattgggcgcgatgagaagcggtgtcggcaagctcgtcatc
ggtacatcggaaggcgtcatcccgcttatcgtcccggtgctgccggaagcgacgtactgg
cgtgacggctggaaaaaagccgcggcgggccagcccggggaaaccatccgggccgctgcc
atcggaccgggccttccccaaacagacgaagtgcagcaggcggctgatcagctgctttct
gccgattatcccgtcatactggacgcgggcgccattacgaaaagaacctatccaaagagg
aaagcccccgtgatcttgacgcctcatcccggcgaattttccagaatgacaggccttccg
attcaagagattcagcagaacagagcgggatatgccgcggaatgggcggagcggcttcac
gtcacgattgtcctgaaaggaaacgaaaccattatcgcttttcccgacggggaatgccgc
aggaatacaaccggaaacggcgcgcttgcaaaaggcgggaccggcgacacgctgacggga
atgattctcggcatgctgtgctgtcatcaagacccgaagcatgccgtattgaacgccgtc
cgccttcacggtgaatgtgcggagttatggacgaaagagcgctccgcccataccttattg
gcgcacgaactttctgaactgctgccgcgtgtatggaaggaatatgaataa

DBGET integrated database retrieval system