KEGG   Bacillus velezensis TrigoCor1448: AJ82_01065Help
Entry
AJ82_01065        CDS       T03161                                 

Definition
(GenBank) holin
Organism
bamt  Bacillus velezensis TrigoCor1448
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1 Cbl_N3
Motif
Other DBs
NCBI-ProteinID: AHK47807
LinkDB All DBs
Position
175938..176201
Genome map
AA seq 87 aa AA seqDB search
MKRFEKGTVVRTVLLLIALINQTMLMFGKSPLDITDAQVNQLADALYTAGSVIFTISTTL
VAWFKNNYVTEKGHKQRAVLKQHDLTK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatttgaaaaaggcacggtcgtccggacggtgcttcttttaattgcgcttatt
aaccaaacaatgttgatgtttggcaaatcacctttggatatcacagatgcacaagtgaat
cagcttgctgatgcgctgtacactgccggctctgtaatatttactatcagcactacgctt
gtagcatggttcaaaaacaactatgtgactgaaaaaggccataagcaaagagccgtttta
aaacagcacgatttgaccaagtaa

DBGET integrated database retrieval system