KEGG   Bacillus velezensis TrigoCor1448: AJ82_01920Help
Entry
AJ82_01920        CDS       T03161                                 

Definition
(GenBank) nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00910  Nitrogen metabolism
bamt01100  Metabolic pathways
bamt01120  Microbial metabolism in diverse environments
Module
bamt_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AJ82_01920
Enzymes [BR:bamt01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     AJ82_01920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C NIR_SIR_ferr Pyr_redox_3 HI0933_like AlaDh_PNT_C GIDA 3HCDH_N NAD_binding_7 FAD_binding_2 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AHK47948
LinkDB All DBs
Position
complement(330556..332973)
Genome map
AA seq 805 aa AA seqDB search
MGKKQLVLVGNGMAGVRAIEEILRVSKDEFEITIFGAEPHPNYNRILLSKVLQGDTDIQD
ITLNDWNWYKENNIQLYTGETVIKVDTENKTVITDADRIQPYDELILATGSVPFILPIPG
ADKQGVTAFRDIKDTDTMLSASKQYKKAAVIGGGLLGLEAARGLLNLGMDVSVIHLAPFL
MERQLDAAAGRLLQNELEKQGMTFFLEKQTEEILGTDRVEGVRFKDGTSIEADLVVMAVG
IRPNTQLGTESGIPVNRGIIVNDYMQTDIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHICGIDTKPYEGSVLSTQLKVSGVEVFSAGDFNESEDKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGGRLFSMIQKEADISETSKISILQPLDQEAGASMTAAMSDDEIICGC
NGVSKGAIIQAIQEKGCTSTDEIKACTGASRSCGGCKPLVEDILQYTLGSEFDASAQKEA
ICGCTSLSRDEVVEEIKAKGLSHTREIMNVLGWKTPEGCSKCRPALNYYLGMINPATYED
DRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSQDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWAELDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQSVLNDPEKRQELNDRMNETLSVH
KDPWQYFLKDKKASKDLFENVVTTS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaacagctagttcttgttggaaatggaatggccggggtaagagcgattgaa
gaaatactgcgtgtttcaaaagacgaattcgagattacaatattcggggccgaacctcat
cccaactataaccgaatccttctgtcaaaagtgctgcaaggcgataccgacattcaagac
attacgttaaacgattggaactggtacaaagaaaacaacattcagctgtataccggtgaa
acagtcatcaaagtcgacacggaaaacaaaaccgtcatcaccgatgcagacagaatccag
ccttacgatgaactcatcctggcgacaggctctgtcccttttatccttccgattccgggc
gcagacaaacaaggcgtcacggctttccgggatataaaagataccgacacgatgctctcc
gcgtcaaaacaatataaaaaagcagccgtcatcggcggaggactgcttggtttggaagcc
gcacgcggactgctgaatctcggaatggacgtgtctgtcatccacctcgccccattcctg
atggagcgacagcttgacgcagcggcgggacgcctgctgcaaaacgaattagaaaaacaa
ggcatgacctttttccttgaaaagcaaaccgaagaaattctcggtactgaccgtgtcgaa
ggcgtacgcttcaaagacggcacaagcatcgaagctgacctggtcgtcatggcggtcggc
atccgcccgaatacacagcttggcacagaaagcggcattccggtaaaccgcggaatcatt
gtcaacgattatatgcagactgacattccgcacatttacgcggtcggtgaatgtgccgag
caccgcggaatcgcatacggtcttgtggcgccgctctatgaacaggcaaaagtgctggcc
aaacatatttgcggcattgacacaaaaccgtatgaaggctccgttctctccactcaatta
aaggtatcaggcgtcgaagtcttctctgccggtgactttaacgaatcagaggacaaaaaa
gcgattaaagtgttcgatgagcaggacggcatttataaaaaaatcgtcctgaggggcaat
caaattgtcggcgctgttttgttcggagacagcagcgagggcggccgcctgttttctatg
attcaaaaagaagccgatatctctgaaacttccaaaatatcaatcttacagcctcttgat
caggaagcaggcgcaagcatgaccgcggcgatgagcgacgatgaaatcatctgcggatgc
aacggcgtttcaaaaggcgcgattattcaagccattcaggaaaaaggctgcacatcaacg
gacgaaatcaaagcatgcaccggggcatcccgttcctgcggaggctgtaaaccgctcgtg
gaagacattcttcaatatacactgggctcagaatttgacgcgtccgcgcaaaaagaagcg
atttgcggctgcacatcactgtcgagagatgaagtcgtagaagaaatcaaagccaaaggg
ctgtcccatacaagagaaatcatgaacgtgctcggctggaaaacgccggagggctgctcc
aaatgccgtcctgccctcaactactacttaggcatgattaatccggctacatacgaggat
gacagaacatcccgttttgtgaacgaacggatgcacgccaatattcaaaaagacggaaca
tactcagtcgtgccccggatgtacggcggcgtgaccaactctcaggatctccgcaagatc
gccgatgtcgtcgacaaatatgagatcccgctcgttaaaatgacaggcggccagcgaatt
gatctcatcggcgtcaaaaaagaagacctgccgaaagtatgggccgagcttgatatgccg
tcaggctacgcgtacggaaaaacactccgcacggtaaaaacgtgcgtaggcgaacaattc
tgccgcttcggcacgcaagactccatggcactgggcattgcgcttgagaaaaaattcgaa
gggctcaatacgcctcataaggtcaaaatggccgtgtccgcctgcccgcggaactgtgcg
gaatcaggcattaaggaccttggcgttgtcggcatcgacggaggctgggagctttatgtc
ggcggaaacggcggaacccatttgcgcgccggtgatttgctgatgaaagtaaaaacgaat
gaagaagtcttagaatatgcgggtgcttaccttcagtactacagagaaacggcaaactat
ctggagcggacatccgcatggcttgagcgcgtcggtttatctcatgtccaatccgtatta
aacgatccggaaaaacggcaggagctcaacgacagaatgaatgagacactctctgtccac
aaagatccgtggcaatacttccttaaagataaaaaagcatctaaagatctattcgaaaat
gtcgtcacgacttcataa

DBGET integrated database retrieval system