KEGG   Bacillus velezensis TrigoCor1448: AJ82_02240Help
Entry
AJ82_02240        CDS       T03161                                 

Definition
(GenBank) iron ABC transporter permease
  KO
K02015  iron complex transport system permease protein
Organism
bamt  Bacillus velezensis TrigoCor1448
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bamt02000]
    AJ82_02240
Transporters [BR:bamt02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    AJ82_02240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3 7TMR-DISM_7TM DUF3180
Motif
Other DBs
NCBI-ProteinID: AHK48001
LinkDB All DBs
Position
409454..410401
Genome map
AA seq 315 aa AA seqDB search
MSHNKKITLLAALAMICIGFFLFYGLGNWEYSLPRRCFKVLAMMLTGGAIAFSTVIFQTI
TNNRILTPGILGLDSLYMLIQTVIVFLFGSMNIVMMNKNLNFVISVGLMVLLSLVLYQLM
FKGEGRNVFFLLLVGVVFGTLFNSLSSFMQMLIDPNEFQVVQDKMFASFNNINTDLLGFA
GAVFLLTGIYVWRFTRFFDVLSLGREHAVNLGIDYDKLVKQMLIVVAILVSVSTALVGPI
MFLGLLVVNLAREFLKTYRHTYLIAGSVLISIVALVGGQFVVEKVFTFSTTLSVIINFAG
GIYFIYLLLKENKSW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataataaaaaaattacgctgctggcggcgctcgccatgatatgtatcggattc
ttcctgttctacggactgggcaattgggaatactccctgccgagacgatgcttcaaagtg
cttgccatgatgcttaccggaggagcgatcgcgttttcaacggtcatcttccagacgatt
acaaataaccgcatactgacaccgggcattttaggcctcgattccctgtatatgctcatt
cagaccgtcatcgtgttcctgttcggttcaatgaatatcgtcatgatgaacaaaaatctt
aatttcgtcatctccgtcgggctgatggtgctcttgtcactcgttttgtatcagctcatg
tttaaaggcgaggggcggaacgtgtttttccttctgcttgtcggcgtcgtgttcggcacg
ctgttcaacagtctgtcatcctttatgcagatgctgattgatccgaatgagttccaggtt
gttcaggacaaaatgtttgccagttttaacaatatcaataccgatcttttagggtttgcc
ggtgctgtctttcttctgacgggcatttatgtctggcggttcacgcggttttttgacgtg
ctgtccctcggcagggagcacgccgtcaacctggggattgattacgataagcttgtgaaa
cagatgctcatcgtcgtcgccattcttgtgtctgtctctacggctcttgtggggccgatt
atgtttttaggactgcttgtcgtcaatctggcgagagagtttttaaaaacctacaggcac
acgtatttaatcgcgggttctgtcctgatcagcatcgtcgcgctcgtcgggggccagttc
gtcgtggagaaagtgttcacgttttccacgacgctgagcgtcatcattaattttgccggc
gggatttattttatctatctgctgttaaaggagaataaatcatggtag

DBGET integrated database retrieval system