KEGG   Bacillus velezensis TrigoCor1448: AJ82_02750Help
Entry
AJ82_02750        CDS       T03161                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00473  D-Alanine metabolism
bamt01100  Metabolic pathways
bamt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AJ82_02750
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AJ82_02750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bamt01011]
    AJ82_02750
Enzymes [BR:bamt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AJ82_02750
Peptidoglycan biosynthesis and degradation proteins [BR:bamt01011]
 Precursor biosynthesis
  Racemase
   AJ82_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHK48087
LinkDB All DBs
Position
495093..496262
Genome map
AA seq 389 aa AA seqDB search
MNTASFYRETWAEINLSAIKENVTHMKKHIGQNVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKRGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSATVPFHLKVDTGMNRLGVKTEEEIQSVLKILSQNPGLVCKGVFTHFATADEKNRDYFL
FQFDRFKTLIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQSEIPF
QLKPAFALHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTSVLI
GGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKGETITMDEIAGRLETINYEVPCT
ISSRVPRMFLENESIMEVRNPLLQDNTNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcatccttttacagagaaacgtgggcggaaatcaacctgtccgcgattaaa
gaaaatgtcacgcatatgaaaaaacacatcgggcaaaacgtccatctcatggcggttgta
aaggcgaacgcttacggccacggagatttggaagttgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgtagccatactggatgaagcgatttcattgagaaaacggggcatt
acagcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgag
tatgacgtaacactcacggggtattctgttgaatggcttcaggaagctgcgcgccacctc
ggaagtgcgacagtgccgtttcatctgaaagtcgacaccggcatgaacagactcggagtc
aaaacggaggaagaaatccaaagcgtgttaaaaatcctcagccaaaatcccggtttagta
tgtaaaggcgtattcacccactttgctaccgcggatgagaaaaacagagattatttcctc
ttccagtttgaccgctttaaaacattgatcgctccgcttcctttaaaagaattgatggtg
cactgcgcgaacagcgctgccggacttcgtcttaaaaaaggcttctttaacgcggttcgt
ttcggcatcagtatgtacgggcttcgtccttctgctgacatccaaagcgaaattccgttt
caattaaagccggcttttgcgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatatacggcagagaaggatcaatggatcggaacg
gttcccatcggctatgcggacgggtggctccgcaagctgagcggcacgtctgtgctgatc
ggcggcaaacggatgaacatcgcgggaagaatctgcatggatcaattgatggtcgaatta
gatcaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaagggagaaacg
atcacgatggatgaaatcgcagggcggcttgagacgattaattacgaggtcccttgtacc
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagataatacaaacaagtag

DBGET integrated database retrieval system