KEGG   Bacillus velezensis TrigoCor1448: AJ82_03695Help
Entry
AJ82_03695        CDS       T03161                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AJ82_03695
Enzymes [BR:bamt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AJ82_03695
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AJ82_03695
    1.1.1.-  
     AJ82_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C PALP F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AHK48241
LinkDB All DBs
Position
complement(649214..650254)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIENIDEPKAEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVGKPHPLT
NEMAPVTMGHEFSGEVVEVGEGVKNYSVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPEELSYEQGALVEPSAVALYAVRQSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQEKAKELGAIIIDPSKTDDVVEEIAKRTNGGVDVS
YEVTGVPVVLRQAIQSTNIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPSV
LALMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKNQVKILVKPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcaagatggcacaatcaaaaagacattcgaatcgaaaacattgatgaacct
aaagcagaaccgggtaaagtcaaaattaaagtcaaatggtgcgggatttgcggaagcgac
cttcatgaatatttgggaggcccgatctttattccggtcggcaaacctcatccgttaaca
aacgaaatggcgcccgtcacgatgggtcacgaattctcaggagaagtcgttgaagtgggc
gaaggcgtcaaaaattacagcgtcggcgaccgtgtcgtcgtggaaccgatttttgccaca
cacggacatcagggagcctataaccttgatgaacaaatgggattcttgggcttagccgga
ggcggcggcggattttctgaatatgtatccgttgacgaagaattgctgtttaagcttcct
gaagagctttcttacgaacagggcgcacttgttgagccgtcagcggtagcgctttacgcc
gtccgccaaagcaaattaaaagcgggcgacaaggcggcagtttttggctgcggaccgatc
gggctgcttgtgattgaagccttgaaagcggccggcgccacagatatttacgcggttgaa
ctttcaccggaacgtcaggaaaaagcgaaagaactcggcgctatcatcattgatccgtca
aaaacggacgatgtcgttgaagaaatcgctaaacgcacaaacggcggcgttgatgtttct
tatgaagtaacaggtgttcctgtcgttctccgccaggcgatccagtcaacaaacattgcc
ggtgaaacggttatcgtcagcatctgggaaaaaggagcggaaattcatccgaacgatatc
gtcatcaaagaacggaccgtaaaagggattatcggataccgtgacatcttcccttccgtt
cttgcactgatgaaagagggctacttctcagcagataagctcgtcacgaaaaaaatcgtg
ctcgacgatctgattgaagaaggcttcggcgctttaatcaaagagaaaaaccaagtgaaa
atcttagtcaaaccgaactaa

DBGET integrated database retrieval system