KEGG   Bacillus velezensis TrigoCor1448: AJ82_05440Help
Entry
AJ82_05440        CDS       T03161                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bamt  Bacillus velezensis TrigoCor1448
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AJ82_05440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: AHK48521
LinkDB All DBs
Position
973253..974656
Genome map
AA seq 467 aa AA seqDB search
MKGSVFRKKSIQDLLAATSGEKSLKRELGAFDLTLLGIGAIIGTGIFVLTGTGAVTAGPG
LTVSFVIAALACLFAALSYAEFASSVPVSGSVYTFTYATLGELLAFIIGWDLILEYMLAV
SAVSVGWSGYFQSFLAGFGIHLPTALTAAPGSIKGTVTFFNLPAFVIVLAITFLLYLGIK
ESKRVNNIMVILKVLVVLLFIAVAAVYVKPHNWQPFIPMGFGGVFSAAALVFFSFIGFDA
VSSAAEETKNPAKDLPKGIIFSLIVCTVLYVTVSAIMTGVVPFARFEGVDHPVSLVLQMA
GQNWVAGIIDIGAVLGMTTVMLVMLYGQTRVMFAMSRDGLVPGALSKVHPKHKTPHVVTW
VFGILSALLGSLVPLDELAKLVNIGTLAAFVLISVAVIVLRKKQPDLPRAFKCPGVPFIP
ILSILFCVFLIINLGATTIFRFFIWLIIGLVIYFLYSRKHSKLNGDL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggagcgtattcagaaagaaaagcattcaggacctgcttgccgcaacgagcggg
gaaaagtcgctgaaaagagagttaggggcctttgatttgacccttctggggataggggcc
atcatcggaacggggatttttgtattaaccggaacaggcgctgtcacggcggggccgggg
ctgactgtttcatttgtcatcgccgctcttgcgtgtttatttgcggctttgtcatatgcc
gaatttgcttcaagcgtcccggtttcgggttccgtctacacgtttacttatgcgacactg
ggtgaacttctcgcgtttatcatcggatgggatttaatcttggaatatatgctcgccgtc
agcgcggtttcggtcggctggtccggctattttcaatcattcttggcgggcttcggcatt
catcttccgaccgcattaacggccgcgccgggatccattaaaggcacggtcacattcttt
aatctccccgcatttgttatcgtgcttgcgattacattccttctctatttaggcattaaa
gaatcgaagcgggtcaataatattatggtcattttgaaggttctggttgttctattgttt
atcgccgttgcggccgtatatgtcaaacctcacaactggcagccgtttataccgatggga
ttcggcggtgttttcagtgccgcggcgctcgttttcttctcttttatcggttttgacgcc
gtctcttccgccgctgaagaaacgaaaaatccggcgaaggatctgccgaaaggaattatc
ttttcattaatcgtctgcaccgtgctgtatgtgaccgtatcggcgattatgacgggcgtc
gttccgtttgcccgctttgaaggcgttgaccatcccgtgtctctcgtcctgcagatggcc
ggacagaattgggtggccgggattattgatatcggcgcagtgttggggatgacaacggtg
atgctcgtcatgctgtacggccagacgagggtgatgtttgccatgtcccgtgacggtttg
gtgccgggggcgctttcaaaagtccatccgaagcataaaacgccgcacgtggtgacgtgg
gtgttcggcatcctgtcggcattactcggctcgctcgtcccgcttgatgaactggcgaag
ctggtgaacatcggcacgcttgccgcatttgtcctgatttccgtggcggttatcgtattg
agaaagaaacagcctgatctgccaagggcttttaaatgtccgggggttccctttattccg
atattgtccattctgttctgcgtgtttttgattattaacctcggcgcaaccaccatattc
cgtttctttatctggctgatcatcggtctggtgatttatttcttatattcgagaaagcat
tcgaaattaaacggggatttgtaa

DBGET integrated database retrieval system