KEGG   Bacillus velezensis TrigoCor1448: AJ82_08335Help
Entry
AJ82_08335        CDS       T03161                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00521  Streptomycin biosynthesis
bamt00562  Inositol phosphate metabolism
bamt01100  Metabolic pathways
bamt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AJ82_08335
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AJ82_08335
Enzymes [BR:bamt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     AJ82_08335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AHK49011
LinkDB All DBs
Position
1496435..1497232
Genome map
AA seq 265 aa AA seqDB search
MTNWTEIDDIAKQWVKEAGTRIRQSMQESLTIETKSNPNDLVTNIDKETERFFIDRIQGT
FPGHRILGEEGQGDKLRSLDGIVWIIDPIDGTMNFVHQKRHFAISIGIFEDGKGKIGLIY
DVMQDELYHAFSGKGAYLNDTPLAPLKEASIEEAIIAINATWVTENRRIDPSILAPLVKR
VRGTRSYGSAALELASVAAGRIDAYITMRLAPWDYAAGCVLLNEVGGIYTTTDGEPFTFL
DNHSVLAGNPAIHKIIFDDYLHADR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattggacggaaattgatgatatcgcaaaacaatgggtaaaagaagccggaacg
agaatcagacaatccatgcaggaaagcttgacgattgaaacaaaatcaaatccgaatgat
ttagtcacaaatattgataaagagacggaacgctttttcattgaccgtatacagggaact
tttcccggacaccggattctcggagaagaagggcagggagataagctccgctcccttgac
ggaatcgtctggatcattgatccgattgacggaacgatgaattttgtccatcaaaagcgg
catttcgcgatctccatcggcatctttgaagacggaaaaggcaaaatcggcttaatttat
gatgtgatgcaggacgaactgtatcacgcattcagcggaaaaggggcttatctgaacgac
acgccgcttgctcctttaaaagaagcttccattgaagaagccattattgcaatcaatgcc
acatgggtgacggaaaacagaaggattgacccgagtattttggcgccgctcgtaaaacgg
gtcagaggaacgcgttcctacggttcggcggcacttgagctggccagtgttgcggccggc
cgcattgacgcatacattacgatgaggctcgcgccgtgggattacgctgccggctgcgtg
ctgctgaacgaagtcgggggcatttacacgaccacagacggcgaaccgtttacgttttta
gacaaccacagcgtgcttgcgggcaatccggcaatacataaaattatctttgacgactat
ttacatgctgacaggtag

DBGET integrated database retrieval system