KEGG   Bacillus velezensis TrigoCor1448: AJ82_13170Help
Entry
AJ82_13170        CDS       T03161                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AJ82_13170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bamt02000]
    AJ82_13170
Enzymes [BR:bamt01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     AJ82_13170
Transporters [BR:bamt02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    AJ82_13170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase G-alpha AAA_15 AAA_16 AAA_29 NB-ARC Rad17 IstB_IS21 AAA_30 AAA_33 AAA AAA_25 AAA_18 AAA_23 NACHT AAA_24 RNA_helicase AAA_5 ATPase_2 Adeno_IVa2 PRK AAA_14
Motif
Other DBs
NCBI-ProteinID: AHK49852
LinkDB All DBs
Position
complement(2486288..2487094)
Genome map
AA seq 268 aa AA seqDB search
MIDHIIREQAEQTKRSPESSILEVKHLSIYYGDKQAVKDVNMNIEKHAVTALIGPSGCGK
STFLRQINRMNDAIPSAISEGEILYEGLNILGEAINVVSLRREIGMVFQKPNPFPKSIYN
NITHALKYAGERRKAVLDDAVEESLTKAALWDEVKDRLHSSALSLSGGQQQRLCIARTLA
MKPAVLLLDEPASALDPISNARIETLLTELKKDYSIIIVTHNMQQALRVSDRTAFFLNGE
VVEYGQTEQIFTSPKAQKTDDYINGKFG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcacatcatcagggaacaagcggaacagacaaagcgttcgccggagtcttca
attttggaagtgaagcatttatcaatttattacggtgacaaacaagcggttaaagatgtg
aacatgaatattgaaaaacatgcggtgacggctctgatcggtccgtccggctgcgggaaa
tcaacatttttgagacagattaacagaatgaacgatgccatcccttcggcaataagcgag
ggagagatcctttatgaagggctgaatattttgggggaagcgattaatgtcgtgtctctc
agacgggagatcggtatggtgtttcaaaaaccgaatccgttcccgaaatccatttacaat
aacatcacacatgcgctgaagtatgcgggggaacgcaggaaagccgttttggatgatgcg
gtcgaggaaagcttaacgaaggcggcgctttgggatgaagtcaaagaccggcttcattca
tcggctctttcgttatcaggcggccagcagcagcgtctttgtatcgcccgtacgcttgcg
atgaaacctgccgtgctacttttagatgaaccggcctcagctctggaccctatttcaaac
gccagaatcgagacgcttttgacagaactgaaaaaagattattcgattattatcgttacg
cataacatgcagcaggcacttagggtgtctgaccgaacggctttctttttaaacggggag
gtggtggaatacgggcagacagaacaaattttcacgagtcctaaagcgcaaaagacagat
gactacattaacggaaagttcggatag

DBGET integrated database retrieval system