KEGG   Bacillus velezensis TrigoCor1448: AJ82_14405Help
Entry
AJ82_14405        CDS       T03161                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00020  Citrate cycle (TCA cycle)
bamt00190  Oxidative phosphorylation
bamt00650  Butanoate metabolism
bamt01100  Metabolic pathways
bamt01110  Biosynthesis of secondary metabolites
bamt01120  Microbial metabolism in diverse environments
bamt01130  Biosynthesis of antibiotics
bamt01200  Carbon metabolism
Module
bamt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AJ82_14405 (sdhA)
   00650 Butanoate metabolism
    AJ82_14405 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AJ82_14405 (sdhA)
Enzymes [BR:bamt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AJ82_14405 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AJ82_14405 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored Not3 DUF844 DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AHK50068
LinkDB All DBs
Position
complement(2705147..2706907)
Genome map
AA seq 586 aa AA seqDB search
MSQSSIIVVGGGLAGLMATIKAAESGTAVKLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPFEHFDDTVYGGDFLANQPPVKAMCEAAPSIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDERTCRGIVAQNLT
NMQIESFRSDAVIMATGGPGIVFGKSTNSMINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKLPMKIFPAVHYSMGGLWV
DYDQMTSIRGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAVKYVSGLETSAEDL
SSSLFDSYVKKEEEKWADIMKMDGDENAYVLHRELGEWMTANVTVVRHNDKLLKTDDKIQ
ELMERFKKININDTTKWSNQGAMFTRQFSNMLQLARVITLGAYNRNESRGAHYKPDFPER
NDDEWLKTTMAKHAGPFEAPEFEYQDVDVSLIAPRKRDYSKKKVAK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaagcattatcgtagtcggcgggggtcttgccggcctcatggcgacaatt
aaagcagcggaatcaggcacggccgttaaattgttttccatcgttccggtcaaacgctct
cactcggtctgcgcgcagggcgggataaacggagctgtcaacacaaaaggggaaggagac
tctccgtttgagcattttgatgacacggtatacggaggcgactttttggcaaaccagcct
cctgtaaaagcgatgtgtgaagcggcgccgtccattatccacttattggaccgcatgggg
gttatgtttaacagaacgccggaagggctcttggacttccgccgtttcgggggtacacag
catcacagaaccgcatacgcgggagcgacgacgggtcagcagcttctttacgcactggac
gagcaggtgcgcagatatgaagtggcgggtctcgtcacaaaatatgaaggctgggaattc
ctcggcgccgttcttgacgatgagcgcacgtgccgcggtatcgtagcccaaaatctgacc
aatatgcaaatcgagtcattccgttctgacgccgttattatggcgacgggaggtcccgga
atcgtattcggaaaatcaacaaacagcatgatcaacacgggatctgccgcatcaatcgtc
tatcagcagggcgcttattatgcaaacggcgaatttatccaaattcacccgacagcaatc
ccgggggacgataaactgcgtctgatgagtgaatcggcgcgcggcgagggcggaagagtc
tggacgtataaagacggaaaaccttggtacttccttgaggaaaaatatccggcttacgga
aacctcgtgccgcgggatattgcgacacgtgaaatctttgacgtgtgcgtgaatcagaaa
ctcggcatcaacggagaaaacatggtgtatctcgatctgtcgcacaaagatccgaaagag
cttgacgttaagcttggcggcattatcgaaatctatgaaaaattcatgggcgatgacccg
cgcaagcttccgatgaaaattttccctgccgttcactattcaatgggcggactgtgggtt
gattatgatcagatgacaagcatccgcggactgttcgcagcgggtgaatgtgattattca
atgcacggaggaaaccgtttaggggcgaactctctgctttccgccatctacggaggaatg
gtggccggaccgaatgcggtgaaatatgtttccggacttgaaacatcagcggaagacctg
tcttcttcattatttgattcctatgtgaaaaaagaagaagaaaaatgggccgatatcatg
aagatggacggcgacgaaaatgcctacgtgcttcaccgtgagctcggagaatggatgacg
gccaacgtcacggtggtccgccacaacgacaagcttttgaaaacggatgacaagatccaa
gagctgatggaacgctttaagaaaatcaatatcaacgatacgacaaaatggagcaaccaa
ggcgcgatgttcacccgccagttctccaatatgcttcagcttgccagagtcatcacgctc
ggcgcatataaccgaaatgaaagccggggagcgcactataaaccggatttccctgaaaga
aatgacgatgagtggctcaaaacgacgatggctaaacatgccggtccgtttgaagctccg
gaatttgaatatcaggatgtcgatgtatcactgattgcgccccgtaaacgcgactactcg
aagaagaaggtggcgaaataa

DBGET integrated database retrieval system