KEGG   Bacillus velezensis TrigoCor1448: AJ82_14765
Entry
AJ82_14765        CDS       T03161                                 

Definition
(GenBank) 5-hydroxymethyluracil DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AJ82_14765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bamt03400]
    AJ82_14765
Enzymes [BR:bamt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     AJ82_14765
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     AJ82_14765
DNA repair and recombination proteins [BR:bamt03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     AJ82_14765
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS FbpA
Other DBs
NCBI-ProteinID: AHK50131
LinkDB
Position
complement(2771683..2772513)
AA seq 276 aa
MPELPEVETVRRTLTGLVKGKTIESADIRWPNIIKKPAEPEEFARQIAGETIRSIGRRGK
FLLFHLDHYVMVSHLRMEGKYGLHQADEPDDKHVHVVFHMTDGTQLRYRDVRKFGTMHLF
APGEEQNALPLSQLGPEPDDEAFTAAYLKERLAKTNRAVKTALLDQKAVVGLGNIYVDEA
LFRARIHPETKANSLSDGQIKTLHTEIKDTLQEAIDAGGSTVRSYINSQGEIGMFQLKHY
VYGKKDEPCKTCGTMISKIVVGGRGTHFCARCQKKS
NT seq 831 nt   +upstreamnt  +downstreamnt
gtgccggaattaccagaagttgaaacggtccggcgcactctgaccggtcttgtgaagggg
aaaacgattgaatcggcggatatcagatggccgaatatcatcaaaaaacccgccgagccg
gaggaattcgcgcggcagattgcaggagaaacaatccgatccatcggaagaaggggaaag
tttttgcttttccatctggatcattatgtcatggtgtcccacctgcggatggaggggaaa
tacggtcttcatcaggccgatgagcctgacgataaacatgtgcacgtcgtgtttcacatg
acggacggaacacagctccgctaccgggatgtccggaaattcggcacgatgcatttgttt
gcgccgggagaggaacagaatgcattaccgctttcacagctcgggcccgaacccgatgat
gaagcatttaccgctgcttatttaaaagagcggcttgcaaaaacgaaccgcgcagtgaaa
acagccctgctcgaccaaaaagcggtcgtcggcctcggcaatatttatgtcgatgaagct
ttattccgggcgcgtattcatcctgagacaaaagcgaacagtctgtcagacgggcagata
aaaacgcttcatacagaaattaaagacacccttcaggaagcgattgacgcgggcgggagc
accgtccggtcttatatcaattctcaaggggagatcggaatgtttcagctcaaacattac
gtatacggcaaaaaggatgaaccgtgcaaaacgtgcggcacgatgatttctaaaattgtg
gtcggcggaaggggtactcatttttgcgcccgctgccaaaaaaaatcataa

DBGET integrated database retrieval system