KEGG   Bacillus velezensis TrigoCor1448: AJ82_16945Help
Entry
AJ82_16945        CDS       T03161                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00071  Fatty acid degradation
bamt00280  Valine, leucine and isoleucine degradation
bamt00281  Geraniol degradation
bamt00362  Benzoate degradation
bamt00592  alpha-Linolenic acid metabolism
bamt01100  Metabolic pathways
bamt01110  Biosynthesis of secondary metabolites
bamt01120  Microbial metabolism in diverse environments
bamt01130  Biosynthesis of antibiotics
bamt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AJ82_16945
   00592 alpha-Linolenic acid metabolism
    AJ82_16945
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AJ82_16945
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AJ82_16945
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AJ82_16945
   00642 Ethylbenzene degradation
    AJ82_16945
Enzymes [BR:bamt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AJ82_16945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHK50488
LinkDB All DBs
Position
complement(3144210..3145385)
Genome map
AA seq 391 aa AA seqDB search
MREAVIVAGARTPVGKAKKGSLAAVRPDDLGALCVKETLKRAGGYEGNIDDLIIGCATPE
AEQGLNMARNIGALAGLPHTVPAITVNRYCSSGLQSIAYGAEKIMIGAGDTVIAGGAESM
SQVPMMGHVTRPNIALAEHAPEYYMSMGHTAEQVAETYGVSREDQDAFAVRSHQNAAKAL
KEGKFNDEIVPVEVSLTEVGDDHKPRKKQFIFSQDEGVRPGTSADVLAKLRPAFSKTGTV
TAGNSSQTSDGAAAVMLMDREKASSLGLAPLVKFRSFAVGGVPPEVMGIGPIEAIPRALK
LAGLELQDIGLFELNEAFASQAIQVIRSLGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL
IHEMKRRNEQFGVVTMCIGGGMGAAGVFELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtcattgtggccggtgcgagaaccccggtcggtaaagcgaaaaaagga
tcgcttgcagccgttcgtcctgatgatttaggcgcgctttgtgtaaaagaaacgctgaaa
cgggcaggcggatatgaaggaaatatcgatgacttaattatcggatgtgcaacacctgaa
gccgaacaaggattaaatatggcgcggaatatcggtgcgctggcggggcttcctcatacg
gtgccggccattacggtgaaccgctactgctcttccgggctccaatccatcgcttacggt
gctgaaaaaattatgatcggcgcgggtgacaccgtcattgcgggcggtgcggaatccatg
tcgcaagttccgatgatgggacatgtgacccgcccgaatatcgctttggcggagcatgcg
cctgagtattacatgagcatggggcacacagcggagcaggtcgccgaaacgtacggcgta
tccagagaagaccaggatgcatttgccgtccgcagccatcagaatgccgcaaaagccctt
aaagaagggaaattcaatgacgaaatcgtgccggttgaagtatcgctgacagaagtcggt
gatgaccataagccgcggaaaaaacaatttatcttttctcaagatgaaggcgttcgtccc
ggcacatcggctgacgtcttggcgaagctccgtccggctttttctaaaacggggaccgtg
acggccgggaactcttcacaaacaagtgacggcgcggcggctgtcatgctgatggatcgc
gaaaaagcttcgtcgctcggattggcgccgcttgtcaaattccgttcctttgccgtaggg
ggcgttccgcctgaggtaatggggatcggtccgattgaagccatcccgcgggcgctcaag
cttgccggactcgaattgcaggatatcgggctttttgaattgaatgaggcctttgcttca
caggccattcaagtcatcagatcgcttgggatagatgaagaaaaagtgaacgtcaacgga
ggcgccatcgcgctcggacatccgctcggatgcacgggaacgaagctgaccctgtcactc
attcatgaaatgaaacggagaaacgagcaattcggcgtggtgacgatgtgcatcggaggc
ggcatgggagctgccggcgtatttgaactcatttaa

DBGET integrated database retrieval system