KEGG   Bacillus velezensis SQR9: V529_01160Help
Entry
V529_01160        CDS       T03384                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bamy  Bacillus velezensis SQR9
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bamy03012]
    V529_01160 (tufA)
   03029 Mitochondrial biogenesis [BR:bamy03029]
    V529_01160 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamy04147]
    V529_01160 (tufA)
Translation factors [BR:bamy03012]
 Eukaryotic Type
  Elongation factors
   V529_01160 (tufA)
 Prokaryotic Type
   V529_01160 (tufA)
Mitochondrial biogenesis [BR:bamy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    V529_01160 (tufA)
Exosome [BR:bamy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   V529_01160 (tufA)
  Exosomal proteins of breast cancer cells
   V529_01160 (tufA)
  Exosomal proteins of colorectal cancer cells
   V529_01160 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: AHZ14142
LinkDB All DBs
Position
127991..129181
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAISTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL
EGDAEYEEKILELMAAVDEYIPTPERDTDKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIINLPEGVEMVMPGDNTE
MIVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatatcggtacaattggacac
gttgaccatggtaaaacaacattaactgctgctatctcaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgtgagcgc
ggtatcacaatctctactgcacacgttgagtacgaaactgacactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgctcaaatg
gacggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccatacatcgtagtattccttaacaaatgcgac
atggtagacgacgaagagcttcttgagcttgttgaaatggaagttcgcgatcttcttagc
gaatacgacttccctggtgatgatgtaccagttgttaaaggttctgctcttaaagctctt
gaaggtgacgctgagtacgaagaaaaaattcttgaacttatggctgcagttgatgagtac
atcccaactccagaacgcgacactgacaaaccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagttgctactggccgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtcttcaagaagaaaacagcaaaacaactgttacaggt
gttgaaatgttccgtaagcttcttgactacgctgaagctggagacaacatcggtgcactt
cttcgcggtgtagctcgtgaagacatccaacgtggacaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttacgttctttctaaagaagagggtgga
cgtcatactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatcaatcttccagaaggcgtagaaatggttatgcctggagataacactgaa
atgatcgttgaacttatctctacaatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtacagttggttcaggcgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system