KEGG   Bacillus velezensis SQR9: V529_05920Help
Entry
V529_05920        CDS       T03384                                 

Definition
(GenBank) hypothetical protein
Organism
bamy  Bacillus velezensis SQR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DPBB_1
Motif
Other DBs
NCBI-ProteinID: AHZ14618
LinkDB All DBs
Position
598597..598965
Genome map
AA seq 122 aa AA seqDB search
MKKLFLALLILAGSTLGAISYSSDASAKKVNGNITWYNGVGKKGSSGKKLGHWDCATKLG
FDVPRNGTKIRAYAKAKPKKVITVYKNDVGRMPNAVLDVSPKAFKALGYPLSKGRVSGHY
SY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagttattcttagccttattgattttagcaggaagcacactgggagcgatcagt
tactcttctgatgcaagtgctaaaaaagtgaacggaaatattacatggtataatggagtc
ggtaaaaaaggatcgtccggtaaaaaactgggacactgggattgcgcgacaaaattagga
tttgacgttccgagaaacggaacgaagatcagagcttatgcaaaagcaaaaccgaaaaag
gttatcaccgtatacaaaaatgatgtaggccgtatgccgaatgccgtattggatgtcagc
ccgaaagcgttcaaagcgctcggatatccgttaagcaaaggaagagtatccggacactac
agctattaa

DBGET integrated database retrieval system