KEGG   Bacillus velezensis SQR9: V529_08910Help
Entry
V529_08910        CDS       T03384                                 

Gene name
glpD
Definition
(GenBank) GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bamy  Bacillus velezensis SQR9
Pathway
bamy00564  Glycerophospholipid metabolism
bamy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    V529_08910 (glpD)
Enzymes [BR:bamy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     V529_08910 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored Cation_ATPase_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AHZ14917
LinkDB All DBs
Position
967785..969452
Genome map
AA seq 555 aa AA seqDB search
MMNHQFSSLERDHMLEDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGT
SSRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFS
TSIGLRVYDYLAGVKKSERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEV
MKEAVKFGAEPVNYSKVKELLYEKGKVVGVLIEDLLSGKEYKVYAKKIVNATGPWVDELR
EKDHSKSGKHLQHTKGVHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVY
KQKLEHPRMTVQDRDYVVSSINYMFPELNITADDIESSWAGLRPLIHEEGKDPSEISRKD
EIWTSQSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGGQDFGGCKTKTMPISGGHVGG
SKNFESFVEAKTKDGLKIGLSQETAKQLAIRYGSNVENVFSRIEGLKDEAEKRQIPVHIL
AEAAYSIEEEMAATPADFFVRRTGRLFFDIKWVQTYKTAVIDYMSDRFQWNDETKEKHTE
WLNTLLHDAVVPLEQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaccaattttcaagtttggaacgggatcatatgctggaagacatgactaaa
aaaacatacgatctgtttattataggcggaggtattacaggtgccggcacggcgcttgac
gcagcttcaaggggaatgaaagtcgctttgagcgaaatgcaggatttcgcggccggcaca
tcaagccgatccacaaagcttgtccacggcggtttgcgttatctgaagcaatttgaagtc
aaaatggttgcagaagtcggtaaggaacgtgccatcgtgtacgaaaacggcccgcacgtc
acgacgccggaatggatgctgcttccgtttcataaaggcggcacgttcggttcattctct
acttccatcggcctgcgtgtgtatgactatttagcgggagtaaaaaaatcagagcgcaga
agcatgctgtctgctaaagaaacgctgcaaaaagagccgctcgtcaaaaaagacggctta
aaaggcggaggctattatgtagagtaccggacggacgatgcgagactgacgattgaagtc
atgaaagaagccgttaaattcggtgcggagcctgtcaactattctaaagtgaaagaactg
ctttatgaaaaaggaaaagttgtcggcgttttaattgaggatctgctgtcaggcaaggaa
tacaaagtttacgccaaaaaaatcgtcaatgcgacaggtccgtgggtcgacgagctgaga
gaaaaagaccatagcaaaagcggaaaacatcttcagcacacaaaaggggtccatcttgta
ttcgaccaatccgtattcccgcttaaacaggcggtgtactttgatacgccggacggccgg
atggtgttcgccattccgcgtgaaggaaaaacatacgtgggtacgaccgatacggtttac
aaacaaaaacttgagcatccgcgcatgacggtgcaggatcgcgattatgtcgtcagctcc
atcaattatatgttcccggaactgaacattacggcggacgatattgaatcaagctgggcc
ggcctcagaccgcttattcacgaagaagggaaagacccgtctgagatctcccgtaaagat
gaaatctggacatctcaatcaggcctgattacgatcgccggaggaaaactgacgggctac
cgtaaaatggctgagcacattgtcgatcttgtccgcgaccgcttgaaagaagagggcggc
caggacttcggcggctgcaagacgaagacgatgccgatttctggcggacatgtcggcggc
tctaaaaacttcgagtcatttgtggaagcaaagacaaaagacggcttgaaaatcggttta
tcacaggaaacggctaagcagttagccatcagatacggctctaacgttgaaaatgtattc
agccggattgaaggtctgaaagacgaagcggaaaaacgtcagattccggttcacattttg
gcggaagcggcttacagcatcgaagaagaaatggctgcgacacctgccgatttcttcgtc
cgcagaacgggaagactgttcttcgacatcaaatgggtgcaaacgtataaaacggccgtg
attgattacatgagcgaccgattccaatggaatgacgaaacgaaagaaaaacacactgag
tggttaaatacgctgctgcacgacgcggttgtcccgctcgaacaataa

DBGET integrated database retrieval system