KEGG   Bacillus velezensis SQR9: V529_12100Help
Entry
V529_12100        CDS       T03384                                 

Gene name
xhlB
Definition
(GenBank) XhlB
Organism
bamy  Bacillus velezensis SQR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1
Motif
Other DBs
NCBI-ProteinID: AHZ15236
LinkDB All DBs
Position
1255218..1255481
Genome map
AA seq 87 aa AA seqDB search
MKFADKGTVVRTVLLLLALLNQTLLMFGKSPLNIQEDQVSQLADTLYAAGSAVFTIITTA
AAWFKNNYVTAKGKKQQALLKINNLSK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgcggacaaaggcacggtcgtcaggacggtgcttcttttgcttgctttattg
aatcaaactttgctgatgttcggcaaatcgccgctgaatattcaggaggaccaggtcagc
cagcttgcagatacgctgtatgccgccgggtcggccgtttttacaatcataacgactgcc
gccgcctggtttaaaaacaattacgttacagcaaaagggaaaaaacagcaggctttatta
aaaataaacaatttatcgaaatag

DBGET integrated database retrieval system