KEGG   Bacillus velezensis SQR9: V529_15170Help
Entry
V529_15170        CDS       T03384                                 

Gene name
prkC
Definition
(GenBank) PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bamy  Bacillus velezensis SQR9
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bamy01001]
    V529_15170 (prkC)
Enzymes [BR:bamy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     V529_15170 (prkC)
Protein kinases [BR:bamy01001]
 Serine/threonine kinases: Other
  Bacterial family
   V529_15170 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Kdo APH RIO1 Haspin_kinase Seadorna_VP7 PBP_N Trp_oprn_chp Pkinase_fungal FixH DUF4366
Motif
Other DBs
NCBI-ProteinID: AHZ15543
LinkDB All DBs
Position
1590376..1592319
Genome map
AA seq 647 aa AA seqDB search
MLTGKRISGRYHILRPIGGGGMANVFLAEDIILEREVAIKILRFDFVNDIDFIRRFRREA
QSASSLDHPNIVSIYDIGEEGDIYYIVMEYVEGMTLKEYINAHGPLHPKEALSIMEQIVS
AIAHAHQNHIVHRDIKPHNILIDHLGHIKVTDFGIATALTSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGKIPFDGESAVSIALKHLQTETPSARKWNPSIPQS
VENIILKATAKDPFHRYESAEDMEADIRTAFDAGRLNEQKFSVQDDEEMTKAIPVITDGA
KAAPQAETPGETDDKEQQPAKKKKRKWPWVLLAVCFIFIMAAVLAVTVFPSLFMPKDVSV
PDVRGMKYEKAEALLEKNGLRADPDITDIEDEKIEEELMVKTDPKAGSTVKEGSSVKLYK
SIGKPKTQLIDVKGRQIGDAKKALKEKGFKHVNVKEENDDSEAGTVIDQNPSAGTDMVAS
DDEVNLTVSLGPADVTLRDLKTYSKEAASGYLEDNGLQLVEKQAHSDDVPEGQVMKQEPS
AGTAVKPGSNVEVTFSLGPEEKPAKTVKEKISIPYEPEHEGDELEVQIAIDDKDHSISDT
YDSFKIKEPTEKTIELKIDQGQKGYYQVMVDHKVVSYKTIEYPKDND
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccggcaagcggatcagcgggcgttatcatatcctccggcccattggcggcggc
ggaatggcaaacgtttttttagctgaggacatcattctcgaacgtgaagtcgcaattaaa
attctgcggtttgactttgtgaatgacattgattttatcaggcgtttcagaagagaagca
cagtcggcatcaagcctcgatcatccgaatatcgtcagtatttacgatatcggggaggaa
ggcgatatttattacattgtcatggaatatgtggaaggcatgacattaaaggaatacata
aacgcacacgggccgctccatccgaaagaagcgctgtccattatggagcagatcgtctcg
gccatcgcccatgcccatcaaaaccatatcgtgcaccgggatattaaaccgcacaatata
ttgatagatcatttagggcatatcaaggtgacggatttcggcatcgccacagcgcttacg
tctacgacaatcacacatacgaattctgtgctgggctcggttcattatttgtctccggag
caggcgagaggcggtctggcaacgaaaaaatcagatatttacgcgctcggcatcgtgctg
tttgagcttttaacaggtaaaattccttttgacggagaatcagccgtcagcatagcgcta
aagcatctgcaaacagaaacgccttccgccagaaagtggaacccttccattccgcagagc
gttgaaaacattattttaaaggcaaccgctaaagacccgtttcaccgctatgaaagcgcc
gaggacatggaagcggacatcagaacggcttttgacgccggcaggctgaatgaacaaaag
ttttccgtgcaggatgatgaggaaatgacaaaagccattcccgttattactgacggcgca
aaagccgcgcctcaggcggaaacgccgggggagacggacgataaggaacagcagcccgcc
aaaaagaaaaaacggaaatggccgtgggttttgctggccgtctgtttcattttcattatg
gcggctgttcttgcggtcaccgtgtttccgtctttatttatgcctaaagatgtaagcgtc
cccgacgtacggggcatgaagtacgaaaaagcggaagccctgcttgaaaagaacgggctc
cgggcggatcctgatataacggacattgaagatgaaaaaatagaagaggaattaatggtc
aaaacggacccaaaagcggggtctaccgttaaagaaggctcttctgtaaaactgtacaaa
agcatcggaaaaccgaaaacccagctgatcgacgtgaaagggcggcagatcggcgacgca
aaaaaagcgctgaaggaaaaaggcttcaaacatgtcaatgtcaaagaagagaacgatgac
agcgaggccggcaccgtaattgatcagaacccgtcagccggcaccgacatggtcgcaagc
gacgatgaagtcaatctaacggtcagcctcggtccggcggacgttacgctgagggactta
aagacttacagcaaagaagcggcttcagggtatcttgaagataacggcctgcagcttgtt
gaaaaacaagcccattcagatgacgtgccggaaggacaagtcatgaaacaagagccgtca
gccggtactgcggttaagccgggaagtaatgttgaagtgacgttctcgctcggacctgaa
gaaaaaccggcgaaaacggtaaaagaaaaaatcagcattccttacgaacccgaacatgaa
ggggacgagcttgaagtgcaaatcgccatcgatgataaggaccacagcatctctgatacg
tatgattcatttaaaataaaagagccgactgaaaaaacaattgaactgaagattgatcag
ggacagaaggggtattatcaagtgatggtcgatcataaagtcgtcagctacaaaacgatt
gaatacccgaaagataatgactga

DBGET integrated database retrieval system