KEGG   Bacillus velezensis SQR9: V529_21660Help
Entry
V529_21660        CDS       T03384                                 

Gene name
yunB
Definition
(GenBank) spore formation protein
Organism
bamy  Bacillus velezensis SQR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YunB Ubie_methyltran ARGLU
Motif
Other DBs
NCBI-ProteinID: AHZ16192
LinkDB All DBs
Position
complement(2259465..2260223)
Genome map
AA seq 252 aa AA seqDB search
MPRYRSALRKRGPLPFRYVLLLSFAFFTISTVISLWMINSSIKPVLMNIGEMETKRVATE
VITESIEEYMSHSDNVKDMVDMKTDENGKVTTMDFNTQMVNSMKAKVTKQLQAHLKEVES
NNKQHETEKGAKTADEIMIDIPLGQVTGNSILGNLGPKIPVRFNLIGDALTDVKTKIKPY
GINNALIDISIFVEIKVKVIIPFASKTSVVTNNIPVSIKAIQGEVPQFYNGSGGSGVTPS
VQLPNEKKEKDK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgcctagataccggagcgctcttcgcaagagagggcctttgccttttcggtatgtgttg
cttctgtcgtttgcttttttcaccatatcgacggtcattagcctttggatgatcaactcc
tcaatcaaaccggtgctgatgaacataggagaaatggaaaccaaacgggtggcaacagag
gtcattacggaatccattgaagaatacatgtctcacagcgacaatgtaaaagatatggtc
gatatgaaaacggatgaaaacgggaaagtcacaacgatggattttaatacacaaatggtc
aacagcatgaaggcgaaagtgacaaagcagcttcaggctcatctgaaggaagtggagtcg
aacaataagcagcatgaaacagagaaaggcgctaaaacggccgatgaaattatgatcgat
attcccttagggcaggtcacgggaaacagcattctcggaaatctggggccgaaaatcccc
gtgcgctttaacctgatcggtgatgcgttaactgatgtaaaaacaaaaataaagccgtac
ggcattaataatgcactgattgatatcagtatttttgtggagattaaagtgaaggtgatt
atcccgtttgccagtaaaacatcagtcgtgacaaataatattccggtctccattaaagcg
attcaaggagaggtgccgcagttttataacggaagcggcggatcaggtgtgacgccttcc
gtccagctgccgaatgaaaaaaaggagaaagacaaataa

DBGET integrated database retrieval system