KEGG   Bacillus velezensis SQR9: V529_32530Help
Entry
V529_32530        CDS       T03384                                 

Gene name
yusL
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bamy  Bacillus velezensis SQR9
Pathway
bamy00071  Fatty acid degradation
bamy00362  Benzoate degradation
bamy00650  Butanoate metabolism
bamy01100  Metabolic pathways
bamy01120  Microbial metabolism in diverse environments
bamy01200  Carbon metabolism
bamy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    V529_32530 (yusL)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V529_32530 (yusL)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V529_32530 (yusL)
Enzymes [BR:bamy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     V529_32530 (yusL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AHZ17279
LinkDB All DBs
Position
complement(3313966..3316335)
Genome map
AA seq 789 aa AA seqDB search
MHKFIKKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNELTKDEMKKGLTLESPEVRSR
LSRSAMQKLLKQKPAPLTSAANLDYITAGNLEDDAAQLKDADWIIEVVVENLDVKKQIFS
LVDEYRKPGSIVSSNTSGISVTKMAEGRSADFKAHFLGTHFFNPARYLKLLEIIPIQETD
PDVLEFMTSFAENTLGKGVVIAKDTPNFIANRIGTYGLLVTVREMLSSGCRIGEVDTVTG
PLIGRPKSATFRTLDVVGLDTFAHVAKNVYDKADGAEKDMFKLPEFMNDMLKNNWLGSKS
GQGFYKKEGKTIYELDPLTMTYGERSKMKTPALEAAKQAKGAKGKMKALVYSDDRAGRLL
WNITSQTLLYSARLLGEIADDIKAIDDAMKWGFGWELGPFEMWDAIGVRKSAERIEEEGA
ALPGWVKEMLDQGHETFYMKENGTPFYYSDGQYRAVKENPKRISLQTLKETKGVISKNSG
ASLIDLGDDVALLEFHTKSNAIGLDIIQMIDNALEETERNYKGLVIGNQGRHFCAGANLA
MILMEAQDDNFMEVDFVIRRFQQTMLNIKYSAKPVVAAPFGMTLGGGTEVCLPAARVQAA
SESYMGLVETGVGLIPGGGGNKELYMNYLDGGSELMDATIKTFETIALAKVSGSAHEARD
MKILSAADRISMNQDHLLHDAKQLAASLYDSGYRPPARKKVKVTGETGCAALLLGADQMR
RSGYLSDHDMKIAKKLAHVIAGGRVPFGMEVSEEYLLEVEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtttataaagaaagcagccgttctcggatcaggcgtcatggggtccggaatt
gccgcgcacttggctaacatcggaattcccgtcctgctgcttgatattgtgccaaacgag
ctgacaaaggatgagatgaaaaaagggctgacattagaaagcccggaggtccgcagcaga
ctgagccgatcggccatgcaaaagctgctgaagcaaaaaccggcgccgctgacttcggct
gccaatctcgactatataacggcggggaatttggaagatgacgcagctcaattgaaggat
gctgattggattattgaagtcgtcgtcgaaaatcttgacgtaaaaaaacagattttctca
ctcgttgatgaataccggaaaccgggaagcatcgtgtcgagcaatacgtccggtatctcc
gtcacaaaaatggcggaaggccgatctgccgattttaaagctcatttcttaggaacccat
ttctttaatccggcccgctacttaaagcttctggaaatcattccgattcaggaaacagat
cctgacgtgctggagtttatgacttcatttgcagaaaacacgcttgggaaaggtgtcgtc
atcgcaaaagacacgcctaactttatcgccaaccgcatcggtacgtacggcctgctggtc
acggtaagagaaatgctttcttccggctgccgcatcggcgaggtggacacggtgaccggg
cctttgatcggcagaccgaaaagcgcgaccttcagaacccttgacgttgtggggcttgat
acgttcgcccatgtggcaaaaaatgtgtatgataaagccgacggcgctgaaaaagacatg
tttaagcttcctgaatttatgaatgacatgctgaaaaacaattggctgggcagcaaatca
ggccaaggtttttacaaaaaagaaggtaaaacaatatatgaactcgatccgctgaccatg
acatacggtgagcgttcgaaaatgaagacgcccgcgttagaagccgccaaacaggcaaag
ggtgccaaaggcaaaatgaaagcgcttgtatattccgatgaccgcgcaggacgcctgctt
tggaatatcacatcgcaaacacttttatactcagcccggcttttaggtgagatcgctgat
gatatcaaagcaattgatgacgccatgaaatggggcttcggatgggagctcggaccgttt
gagatgtgggatgccatcggcgtcagaaaatcagcggagcggatcgaagaagaaggcgca
gcactccccggctgggtgaaagaaatgcttgatcagggccatgaaacattttatatgaag
gaaaacggaacaccattttactattcagacggccaatacagggctgtgaaagaaaatccg
aaacggatcagcctgcaaacgttaaaagaaacaaaaggcgtgatcagtaaaaacagcggc
gcaagtctgattgatctcggcgatgatgtcgcgctgctggaatttcatacgaaaagcaac
gcgatcggcttagacattattcagatgattgacaatgcgcttgaggaaacggagcggaat
tataaaggacttgtcatcggaaaccaaggcagacatttctgcgcgggagcaaaccttgcg
atgattttgatggaagctcaggatgataacttcatggaagtcgattttgtcatccgccgt
tttcagcagacgatgctgaacatcaaatacagcgctaaacccgttgtcgcggcgccattc
gggatgactctcggcggcggcacggaagtctgtctcccggcggcacgcgttcaggcggcg
agcgaatcgtatatgggtctcgttgaaaccggcgtcggccttattccgggcggcggagga
aacaaagagctgtacatgaattatttggacggcggaagtgaactgatggacgcaacgatt
aaaacctttgaaacaatcgcgcttgccaaagtgtccggttcggcacacgaagcccgtgat
atgaagattttgtccgcagcagaccgtatcagcatgaatcaggatcacctgctgcacgat
gcgaaacagctggctgcttccttatatgacagcggataccgcccgcctgcccgcaaaaaa
gtgaaagtcaccggagaaaccggctgtgcggcattactgctcggagcagaccaaatgaga
cggtcgggttatttatccgatcacgatatgaagattgcgaagaagctggcccatgtcatt
gccggcggaagagtcccgttcggcatggaggtttcagaagaatatttactcgaggttgaa
agagaagcctttttaagcctcgctggcgaggcgaaatctcaagcgagaatgcagcatatg
ctcgtcaaaggcaaacctttacggaactag

DBGET integrated database retrieval system