KEGG   Bacillus velezensis SQR9: V529_32560Help
Entry
V529_32560        CDS       T03384                                 

Definition
(GenBank) hypothetical protein
Organism
bamy  Bacillus velezensis SQR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Herpes_UL25
Motif
Other DBs
NCBI-ProteinID: AHZ17282
LinkDB All DBs
Position
3317694..3317951
Genome map
AA seq 85 aa AA seqDB search
MNNQEQHGNLPPAVISTKDHLYLEDMLNWNLLAMKKAHFMAEHCQNQTLKQELDQIGRMH
QKHYQHILGRLNPDQGGQTTTGYMQ
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccaagagcagcacggaaacttgccgcctgccgtcatctcaacgaaagaccat
ttgtatcttgaggacatgctgaactggaatctgcttgccatgaaaaaagcgcattttatg
gcggaacactgccagaatcagacgttaaaacaagagcttgatcagatcggccggatgcat
cagaagcattatcagcacatattgggccgcttgaaccccgatcaaggcggacagacaaca
acaggctatatgcaatag

DBGET integrated database retrieval system