KEGG   Bacillus anthracis Ames: BA_0599Help
Entry
BA_0599           CDS       T00129                                 

Definition
(RefSeq) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
ban  Bacillus anthracis Ames
Brite
KEGG Orthology (KO) [BR:ban00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ban01002]
    BA_0599
Enzymes [BR:ban01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BA_0599
Peptidases [BR:ban01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BA_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-GeneID: 1087962
NCBI-ProteinID: NP_843132
UniProt: A0A2P0H9V8
LinkDB All DBs
Position
613589..615289
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRLQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPVKQEAPK
QEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQDNTRGATIFTYDAKNRSTL
PGTLWVDADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNRNSINDAGAPLKSTVHYGSRY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTEYSSDLIYQNESGALNEAISD
VFGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGTGDNGGV
HTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIYYRANTQYFTQSTTFSQARAGLVQ
AAADLYGASSAEVAAVKQSYSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcttttgcagattctaaaaatgtgctctctacgaagaagtacaatgag
acagtacagtcaccggagtttatttctggggatttaactgaagcaactggtaagaaagca
gaatctgttgtgtttgattacttaaatgcagcaaaaggtgattataagttaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagcgaagaaagatgctgtaactgattcaaca
gtattacgtttgcaacaagtttacgaaggagtacctgtatggggttctacgcaagtagct
cacgtaagtaaagatggttcattaaaagtattgtctggaacagttgcacctgatttagac
aaaaaagaaaagttgaaaaataaaaataagatcgaaggcgcaaaagcaattgaaattgcg
caaaaagatttaggtgttacacctaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatacgttgtaaatttaaacttcttagagcca
agcccaggaaactactactatttcattgaagcggacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataagtcaccagttaagcaagaggcacctaaa
caagaagcgaaaccggctgtaaagcctgtaacaggcacaaatgcagtgggtactggtaaa
ggtgtattaggagatacgaagtcacttaatacaacgttatctgcatcatcttactattta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaaccgctcaacatta
ccaggaacgttatgggtagatgcggataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcactactatgctggtagaacatatgattactataaagcgacatttaataga
aactctattaatgatgcaggagcaccattaaaatcaacagttcattatggaagtagatat
aataatgcgttctggaatggctctcaaatggtatacggagatggtgatggtgtaacattc
acttcattgtctggtggaattgatgtaattggccatgaattaacgcatgctgttacagag
tatagctcagatttaatttatcaaaatgaatcaggagcattaaatgaagctatttcagat
gtatttggtacattagtagagtattatgataaccgtaaccctgattgggaaattggtgaa
gatatttacacgcctggtaaagctggagatgcacttcgctctatgagtgatccaacgaaa
tatggtgatccagatcattattctaagcgttacacaggtactggtgataacggtggcgtt
catacaaatagcggtattattaacaaagcggcttacttactagcgaatggtggtacgcat
tacggtgttactgtaaacggtattggtaaagataaagtaggagcgatttattaccgtgca
aatacgcaatatttcacacaatctactacgtttagtcaagctcgtgctggattagtacaa
gctgcagctgacttatatggtgctagctctgcagaagtagcagcagttaagcaatcatat
agtgctgttggcgtaaactaa

DBGET integrated database retrieval system