KEGG   Bacillus anthracis Ames: BA_2079Help
Entry
BA_2079           CDS       T00129                                 

Gene name
dal2
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00473  D-Alanine metabolism
ban01100  Metabolic pathways
ban01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ban00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BA_2079 (dal2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BA_2079 (dal2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ban01011]
    BA_2079 (dal2)
Enzymes [BR:ban01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BA_2079 (dal2)
Peptidoglycan biosynthesis and degradation proteins [BR:ban01011]
 Precursor biosynthesis
  Racemase
   BA_2079 (dal2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Urease_linker DUF4170
Motif
Other DBs
NCBI-GeneID: 1087070
NCBI-ProteinID: NP_844479
UniProt: A0A2P0HDB1
LinkDB All DBs
Position
1946768..1947943
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKAAIEAG
INQLAIAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDVMMTVYRSEDLQGINEIA
NRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMEPSNTFQNMVRVGIGIYGMYPSKEVNH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
HALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacat
aatgtaaaagaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatgggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcagga
ataaatcagcttgcaattgcatttgtagatgaagcgatagagttaagagaagcaggaatt
aacgtgccgattttaattttaggctatacatcagtagcggctgcggaagaagcaattcaa
tatgacgttatgatgaccgtttatagaagtgaagatttacaaggtataaatgaaatcgca
aaccgtcttcaaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcatt
ggtttacaggaagaagaggttaaaccatttttagaggaattaaaacgtatggagtatgta
gaggtagtgggaatgtttacacattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcat
attccatatattcatagttcaaatagtgcaggttcaatggaacctagcaatacatttcaa
aatatggttcgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtaaatcat
tcagttgtttcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcat
gcgaagaaaaatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatgg
attgccaccgtaccgattggttatgctgatggttataatcgtcagttgtctaataaaggg
catgcattaataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctc
atgttagacgtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggt
aaacaaggcgaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaac
tatgaagttacatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaa
acaactgctgttgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system