KEGG   Bacillus anthracis Ames: BA_3551Help
Entry
BA_3551           CDS       T00129                                 

Gene name
amyS
Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00500  Starch and sucrose metabolism
ban01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ban00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BA_3551 (amyS)
Enzymes [BR:ban01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BA_3551 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-GeneID: 1084526
NCBI-ProteinID: NP_845825
UniProt: A0A384KUE3 A0A0F7RFW2
LinkDB All DBs
Position
complement(3255340..3256881)
Genome map
AA seq 513 aa AA seqDB search
MFKKITIVGLSVVLFLPSIYGESKVYADTINNGTLMQYFEWYAPSDRNHWNRLRTDAENL
AQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHK
QNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNVEVSGDYEISAWTGFNFPGRGDNYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTL
NNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTA
RKNFAYGTQRDYLDHPDVIGWTREGDSVHANSGLATLISDGPGGSKWMDVGKNNAGEVWH
DMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaaataacaatagtcggcttgtcggttgttttgtttttacctagtatatat
ggggagagtaaagtgtatgcagatacgattaacaatggaacgttaatgcagtattttgag
tggtatgctccaagtgataggaatcattggaatcgtttgcgcactgatgctgaaaattta
gcgcaaaaaggaattacatctgtttggatacctcctgcgtataaaggaactacgcaaaat
gatgtaggatatggagcatatgatttatatgatttgggtgaattcaatcaaaagggaaca
gtgcggacgaaatatgggacaaaagcacaattgaaatctgcaattgaagctttacataag
caaaacatcgatgtatacggcgatgtagttatgaatcataaaggtggagcagattatact
gaaactgtaacagctgttgaggtagaccgtaacaatcgaaatgttgaggtatcaggtgat
tatgaaattagtgcatggacagggtttaactttcctggacgtggagataattattctaat
ttcaaatggaagtggtatcattttgacggaacggattgggatgaaggaaggaaattaaat
cgaatttataaatttaggggtataggtaaagcatgggactgggaagtgtctagtgagaat
ggaaattatgattatttgatgtatgcagaccttgattttgatcatccagatgttgcgaat
gagatgaaaaattgggggacgtggtatgcgaatgaattaaatttagatggctttcgttta
gatgctgttaaacatattgatcatgaatatttacgcgattgggtaaatcatgttaggcag
caaacggggaaagaaatgtttacggtggctgaatattggcaaaatgatatccaaacttta
aataattatttagcgaaagtcaattataatcaatctgtatttgatgcaccactgcattac
aattttcattatgcttcaaaaggaaatgggaattatgatatgagaaatattttaaatgga
acagtaatgcaaaatcatcctgcactcgcagttactcttgttgagaatcatgattctcag
cctggtcagtcattggaatctgtagtaagtccgtggtttaaaccgttggcatatgcattt
attttaactcgtgcagagggatatccttcagttttttatggtgattactatgggacaagc
ggaaatagtagttatgaaattccagcgttaaaagataaaattgatccgattttgacagca
cgaaaaaactttgcatatggtacgcagcgtgattatttagaccatccagatgtgattgga
tggacgagagaaggtgatagtgtacatgctaattctggtttagcaacattaatctctgat
ggaccgggaggatcaaagtggatggatgttggaaagaataatgcaggggaagtatggcat
gatatgacgggtaatcaaacaaatactgtaacaattaataaggatggatgggggcaattc
catgtaagtggaggatcagtttccatatatgttcagcagtga

DBGET integrated database retrieval system