KEGG   Bacillus anthracis Ames: BA_4753Help
Entry
BA_4753           CDS       T00129                                 

Gene name
sdhB
Definition
(RefSeq) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00020  Citrate cycle (TCA cycle)
ban00190  Oxidative phosphorylation
ban00650  Butanoate metabolism
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01130  Biosynthesis of antibiotics
ban01200  Carbon metabolism
Module
ban_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ban_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ban00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BA_4753 (sdhB)
   00650 Butanoate metabolism
    BA_4753 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BA_4753 (sdhB)
Enzymes [BR:ban01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BA_4753 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BA_4753 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-GeneID: 1083838
NCBI-ProteinID: NP_846959
UniProt: A0A348AAE1
LinkDB All DBs
Position
complement(4320367..4321128)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQAFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNQTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagacggaccagacgcgcaagcg
tttgatcaagagtttgaaattccttatcgtccgaatatgaatattatttcggcgcttatg
gaaattcgccgtaatcctgttgattcaaaaggaaaccaaacgactccgattgcgtgggat
atgaactgtttagaggaagtgtgtggtgcatgttcgatggtgattaacggaaaaccacgt
caatcatgtacagcacttatcgatcaattagagcaaccaattcgcttaaaaccgatgaag
acattcccggttgttcgtgacttacaagttgaccgtagtcgcatgtttaatgctctaaaa
cgtgttaaagcttggattccaattgatggtacgtatgacttaggaccagggccaagaatg
ccagagaagaaacgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaatagtaaatctgactttattggaccagcaccgttatca
caagctcgtttattcaactcacatccaacgggtgaaatgcataaagcagatcgcttacgt
gcaattatgggtgatggaggacttgcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccaaagggtattccattaacaacttcaattgcggcgttaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgacaataactattaa

DBGET integrated database retrieval system