KEGG   Bacillus anthracis Ames: BA_4838Help
Entry
BA_4838           CDS       T00129                                 

Gene name
icd
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00020  Citrate cycle (TCA cycle)
ban00480  Glutathione metabolism
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01130  Biosynthesis of antibiotics
ban01200  Carbon metabolism
ban01210  2-Oxocarboxylic acid metabolism
ban01230  Biosynthesis of amino acids
Module
ban_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ban_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ban00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BA_4838 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BA_4838 (icd)
Enzymes [BR:ban01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BA_4838 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 1083987
NCBI-ProteinID: NP_847041
UniProt: A0A0J1HW46
LinkDB All DBs
Position
complement(4400025..4401317)
Genome map
AA seq 430 aa AA seqDB search
MTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKKIVWKE
VLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLYVCLR
PVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMGVNKIR
FPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNWGYEVA
EQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFANELIK
NMDVAIIKNA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacaggtgaaaaaattactgtaactaatggtgttatgaatgtaccaaacaatccg
attattccatttatcgaaggagatggaattggtcctgatatttgggcagctgcatctcgt
gtactagaagcagcagttgaaaaagcttatgatggtgagaagaaaatcgtttggaaagaa
gtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggttaccagaagaaacttta
aatttaattcgtgaatatttaatcgcgattaaaggtccacttacaactccagttggcggt
ggtattcgttctctaaacgtagcacttcgtcaagaattagatttatatgtatgtctacgt
ccagttcgttattttgaaggtgttccttcacctgtaaaacgtccggaagatactgatatg
gttattttccgtgaaaatacagaagacatttatgctggaattgaatatgcgcaaggatct
ccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggtgttaataaaatccgc
ttcccagaaacatctggtattggtattaaaccaatctcagaagaagggacaaagcgtctt
gttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttctgttacattagttcat
aaaggaaacattatgaaattcacagaaggtgctttcaaaaactggggttacgaagtagcg
gaacaagaattcggcgacaaagtatttacttgggctgaatatgatcgtatcgttgagaaa
gatggtaaagatgcagcgaataaagcgatggcagacgctgaagtggctggaaaaatcatc
gtaaaagattctattgcagacatcttcttacaacaaattttaactcgtccacgtgagttc
gatgttgttgcaacaatgaacttaaacggagactacatctctgatgcacttgctgcacaa
gtaggtggaattggtattgcacctggtgcaaacattaactatgtgactggacatgctatc
tttgaagctacgcacggtacagctccaaaatatgcaggtttagataaagtaaacccatct
tcagttcttctttctggtgtattattattagagcacttaggatggaacgaagctgcgaaa
ttagtaactgcttcagttgagaaaacaattgcttcaaaagtagtaacttatgatttcgca
cgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgctaatgaacttattaaa
aacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system