KEGG   Bartonella ancashensis: PU02_0107Help
Entry
PU02_0107         CDS       T04086                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
banc  Bartonella ancashensis
Pathway
banc00473  D-Alanine metabolism
banc01100  Metabolic pathways
banc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:banc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PU02_0107
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PU02_0107
Enzymes [BR:banc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PU02_0107
Peptidoglycan biosynthesis and degradation proteins [BR:banc01011]
 Precursor biosynthesis
  Racemase
   PU02_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALE02921
UniProt: A0A0M3T2I8
LinkDB All DBs
Position
104357..105478
Genome map
AA seq 373 aa AA seqDB search
MDNPANYEISTVLPYTAVATIDIGAIVANYKTLAQRVAPIECAAVIKANAYGMGAEKVAP
ALYQVGCRIFFVAQINEALQLKNILPPNTILAILNDFPPQTEEWVAQAGIVPVLNSWQTI
ERWQTLCQKKKQRFPAIIQIDTNMNRLGLNQEELHLLIKRPLIFEKATIKYIISHLSSGD
NVAHPSNNNQLAVMQNLLTQLPPCKASLANSGGIFLDSAFHFDLVRPGITLYGINPHDKH
QTFLKPVLKLEAQVIQSRFVDSGASVGYGGSFVTNRPSILTTIAIGYADGWPYSLSNRGS
VYFKEHRLPIVGKVSMDSTIVDATDLEHKKPERGDWVELIGRHQRIEDIAVDANTIPYEI
LTSLGARCKRIYI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggataatcctgccaattatgaaataagcacagtcctgccctatactgccgttgcaacc
attgatattggtgccattgttgcaaattataaaactttagcccaacgcgttgcaccaata
gagtgtgcagctgtcataaaagccaatgcttatggaatgggtgctgaaaaagttgctcct
gcactttatcaagtaggctgtcgcattttctttgttgctcaaattaatgaagcactgcaa
ttaaaaaatatcctgcctccaaatactattctcgcgatcctaaatgattttccgccacaa
actgaagagtgggtagctcaagctgggattgtccccgttctcaattcttggcaaacgatc
gaacgctggcaaacactctgtcaaaaaaagaagcagagatttcccgcaatcattcaaatt
gatactaatatgaatcgattagggcttaatcaagaagaactacatttattaatcaaacgt
ccccttatctttgaaaaagcaaccataaaatacattataagccatctttctagcggagat
aatgtcgctcacccatctaataataaccaattagctgttatgcaaaatcttctcacacag
cttcctccatgtaaagcttctcttgctaactctggaggaattttccttgattcagcattt
cattttgacctcgttcgtccaggtatcacactctatggaataaaccctcatgataaacac
caaacattcctcaaacctgttttaaaacttgaagcacaagtcatccaaagccgttttgtt
gattcaggagcttccgttggctacggaggaagctttgttacaaaccgcccaagcatcctc
acaactattgccatcggctacgctgacggttggccatatagcctttctaacagaggttcc
gtttattttaaggagcacaggctccccattgttgggaaggtatctatggactccaccatc
gttgatgcaaccgatctcgaacacaaaaaacctgaacgaggtgattgggtagagctcatt
ggacggcaccaaagaattgaagatattgccgtagatgctaacactattccttatgaaatt
ttgacatctctcggtgcgcgctgcaaacgtatttacatctaa

DBGET integrated database retrieval system