KEGG   Bartonella ancashensis: PU02_0566Help
Entry
PU02_0566         CDS       T04086                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
banc  Bartonella ancashensis
Pathway
banc00061  Fatty acid biosynthesis
banc00780  Biotin metabolism
banc01100  Metabolic pathways
banc01130  Biosynthesis of antibiotics
banc01212  Fatty acid metabolism
Module
banc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:banc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PU02_0566
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PU02_0566
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PU02_0566
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:banc01004]
    PU02_0566
Enzymes [BR:banc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PU02_0566
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PU02_0566
Lipid biosynthesis proteins [BR:banc01004]
 Fatty acid synthase
  Component type
   PU02_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ALE03380
UniProt: A0A0M4LI81
LinkDB All DBs
Position
complement(622552..623370)
Genome map
AA seq 272 aa AA seqDB search
MNGLMKGKRGLIMGIANDHSIAWGIARRLAEEGAELALTYQGSAFGKRVQPLAEKLNCNL
VLECDVEKIETVDHVFKYLEEKWKTIDFVVHAIGFSDKAELKGRYVDATTRENFKRTMVI
SAYSFTEIAQYASKLMPNGGMLLTLTYGASQQVVPNYNVMGIAKAALEAMVRYLAADFGP
QNIRVNAISAGPVRTLAGNGIAAARAIFSYQRRNSPLRRTVDIDEIGKSALYLLSDLSSG
VTGEIHYVDSGYNIISMPTLEELKHGEEIHEE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtctaatgaaaggcaagcgtggtctcattatgggaattgctaatgatcattca
attgcctggggtatcgcacgccgattagcggaggaaggtgctgaacttgccttaacttat
caggggagtgcttttggaaaacgtgttcagcctttagcagaaaagcttaattgcaactta
gtactcgaatgtgatgttgagaaaatcgaaactgtcgatcatgtattcaaatacctggaa
gaaaaatggaaaactatagactttgtcgttcatgctattggtttctctgataaagcagag
ctgaaaggacgatatgttgatgcgacgacacgtgaaaattttaagcgtacaatggttata
tcggcttactcttttacagaaattgctcaatacgctagtaagctcatgcccaatggagga
atgcttttgacactcacatatggagcttcacagcaagttgttcctaattataatgtcatg
ggcattgccaaagcagccttagaggctatggtacgctatttagcagcagattttggtcct
caaaatatccgtgtcaacgcaatttcagctggccctgttagaacattagctggtaacggt
atcgctgcagcacgagcaattttctcatatcagcgtcgcaattcaccacttcgtcgtacg
gttgatattgatgaaattggaaaatctgctctctatttgctttctgatctgtcatcaggc
gttactggtgaaatccactacgtagattcaggatacaacataatatccatgccaacactt
gaagaactaaagcatggtgaagaaatacacgaagagtga

DBGET integrated database retrieval system