KEGG   Bartonella ancashensis: PU02_0810Help
Entry
PU02_0810         CDS       T04086                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
banc  Bartonella ancashensis
Pathway
banc00473  D-Alanine metabolism
banc00550  Peptidoglycan biosynthesis
banc01100  Metabolic pathways
banc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:banc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PU02_0810
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PU02_0810
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PU02_0810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:banc01011]
    PU02_0810
Enzymes [BR:banc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PU02_0810
Peptidoglycan biosynthesis and degradation proteins [BR:banc01011]
 Precursor biosynthesis
  Amino acid ligase
   PU02_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ALE03624
UniProt: A0A0M4M3L3
LinkDB All DBs
Position
857055..857975
Genome map
AA seq 306 aa AA seqDB search
MKGKHVAVLMGGFSSERSVSLSSGTACADALESQGFNVSRLDVNEHIASVLEELQPAVAF
NALHGLFGEDGCIQGILEYLKIPYTHSGVMASALAMDKGRAKIVASSAGVSVAPSRVMSR
FDIGPEHLMELPYVIKPVHEGSSFGVIIVKDDDPVPLQDVVSPKWVYDDEVIVERYIPGR
ELTCAVLGGEALEVCEIVPNQNFTFYDYDAKYKLDGSFHICPAKLSPNIYQKVQRMSLIA
HKAIGCRGVSRSDFRYDDKTEELIWLEINTQPGMTLTSLVPDIAKASGRTYEDVVKWIVE
DASCMR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtaagcatgtagccgtattgatgggaggattttcatctgaacgctctgtaagc
ttatcttcaggtactgcctgtgccgatgctttggaatcgcagggttttaatgtgagccgt
ttggatgtcaatgagcatattgcttctgttcttgaagagttgcagccagctgttgctttt
aatgcattacatggtttatttggtgaagatggttgtattcaaggtattcttgagtatttg
aagattccatatactcattctggggttatggcgtcagcgttggcaatggataaggggaga
gcaaagattgttgcttctagtgctggtgtttctgttgcaccttctcgcgtaatgagccgc
tttgatatagggccagagcatcttatggagctgccatatgtgattaaacctgtccacgag
gggtcaagttttggtgttatcatcgtgaaggatgatgatcccgttccattgcaagatgtg
gtaagtcccaagtgggtctatgatgatgaagtcattgttgaaagatacattccagggcgt
gagctaacttgtgctgttttgggaggtgaagctctggaagtttgcgagattgtgcccaat
cagaattttacgttttatgattatgatgccaaatataaattggatggttcttttcatatt
tgtcctgcaaaactttcaccaaatatttaccaaaaagtgcaaagaatgtctttgatagcg
cataaagcaattggttgccgaggtgttagtcgttctgattttcgttatgacgataagacg
gaagagttgatttggcttgaaattaatacacagcccggaatgactttaacttctcttgtt
cccgatattgcaaaggcaagtggtcgcacttatgaggatgtggttaagtggatagtggag
gatgcatcatgtatgcgttaa

DBGET integrated database retrieval system