KEGG   Bartonella ancashensis: PU02_0858Help
Entry
PU02_0858         CDS       T04086                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
banc  Bartonella ancashensis
Brite
Translation factors [BR:banc03012]
 Eukaryotic Type
  Elongation factors
   PU02_0858
 Prokaryotic Type
   PU02_0858
Mitochondrial biogenesis [BR:banc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PU02_0858
Exosome [BR:banc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PU02_0858
  Exosomal proteins of breast cancer cells
   PU02_0858
  Exosomal proteins of colorectal cancer cells
   PU02_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ALE03672
UniProt: A0A0M4LT09
LinkDB All DBs
Position
917853..919028
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEERARGITIST
AHVEYETEQRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPGDDIPVVKGSALAALEDSNKS
IGEDAVRLLMSEVDKYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGVIKVGEEI
EIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGVDREGIERGQVLAKPGSVTPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVAMDISL
IVPIAMEEKLRFAIREGGRTVGAGIVSKIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagagcaaatttgaacgtacgaagccgcatgttaatattggaacgattggtcac
gttgatcatggtaagacctcgttgactgcagcgattacgaagtattttggtgagttcaaa
gcgtatgatcagattgatgctgcgcctgaagagcgggctcgtggcataactatttcaact
gcgcacgttgaatatgaaacggagcaacgccattatgcgcatgtggattgtcctggtcat
gctgattatgtaaagaacatgatcacgggtgcagctcaaatggatggtgctatattggtt
gtttctgcagcggatggtccgatgcctcagacacgtgaacatattttgttggcgcgtcag
gtgggtgttcctgcgattgttgtttttttgaataaagttgatcaggttgatgatgcggag
cttttggagcttgttgagcttgaagttcgagaacttctttcgaagtatgattttccaggt
gatgatatacctgttgttaaaggctccgctttggcggctcttgaagattccaacaagagt
ataggagaggatgctgttcgccttttaatgagtgaggttgataagtatataccgacgcca
gaacgtccaattgatcagccttttttgatgcctattgaggatgttttttcgatttcgggt
cgtggaacggttgttacaggtcgtgttgagcgtggtgttattaaagttggtgaagaaatt
gagattatagggattcgtcctacgtcgaagacaacagttacgggcgttgaaatgtttcgt
aagcttttggatcaaggtcaggcgggtgataatattggtgccttgcttcgtggtgttgat
cgtgaagggattgagcgtgggcaagttttggcgaagcctggttctgttacacctcatact
aagtttaaagccgaagcttacattttaacgaaagatgaggggggtcgtcatacgcctttc
tttacaaattatcgtccacagttttattttcgtactacggatgtgacggggattgttact
cttcctgaaggtacggagatggttatgcccggtgataatgttgcgatggatatttctctg
attgttccaattgcaatggaggaaaagttgcgttttgcgatccgtgaaggtggccgcacc
gtcggagcaggtatcgtctctaaaattgttgaataa

DBGET integrated database retrieval system