KEGG   Bartonella ancashensis: PU02_0950Help
Entry
PU02_0950         CDS       T04086                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
banc  Bartonella ancashensis
Pathway
banc00970  Aminoacyl-tRNA biosynthesis
banc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PU02_0950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:banc03029]
    PU02_0950
Enzymes [BR:banc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PU02_0950
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PU02_0950
Mitochondrial biogenesis [BR:banc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PU02_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALE03764
UniProt: A0A0M4LK28
LinkDB All DBs
Position
1020469..1021953
Genome map
AA seq 494 aa AA seqDB search
MTDLTTLTIAQARDALTKGDFKATELTESYLKAIKEANLTLNVYVAITEEQAMKMAVESD
SRFFKKEAGILEGIPLGIKDNFATRDVHTQACSYILDGFKPKYESTVTANLWKSGAVMLG
KLNMDEFAMGSSNKTSYYGPAINPWRKLNSNENLVPGGSSGGSSAAVAARLCAAATATDT
GGSIRQPAAFTGTVGIKPTYGRCSRWGIIAYASSLDQAGPIGRTVQDCAIMLKSMASFDK
KDSTSVDLPVPDYESYLGKSIKGMRIGIPKEYQIEGISSEIIELWQKGVHWLQEAGAEIV
DVSLPHTKYALPAYYIVASAEASSNLARYDGVRFGLRIPGKDIVEMYENTRSAGFGNEVK
RRILIGTYVLSAGYYDAYYLKAQKVRTLIKHDFDQCFSSGVDAILTPATPTPAFGITDET
IKNDAITMYLNDIFTVPVNMVGLPGISVPAGLSSSGLPLGLQLIGKPFSEEVIFQAAHII
EQAAGTLSADKWWP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttaacaacattgactatcgcacaggctcgtgatgccttaacgaaaggtgat
tttaaagcaacagagctgacagaatcttacctaaaagccataaaagaagccaatttaact
ttgaatgtttatgtagcaattactgaagaacaagcaatgaaaatggcggttgaatcggac
agtcgtttttttaaaaaagaggcgggtattctagaaggaattccgttaggaattaaagat
aacttcgcgacaagggatgttcatactcaagcttgttcatatatcctcgatggatttaag
ccaaaatacgaatcaactgtgaccgctaatctgtggaaaagtggtgcagttatgttaggt
aagcttaatatggatgaatttgccatgggctcttctaataaaacatcctattatggacca
gctatcaatccgtggcgtaaattgaactctaatgaaaatcttgttccgggtggttcttca
ggaggatcctctgccgcagttgcggcacggctttgtgcagctgcaacagcaacagatact
ggcggatcgatacgccaacctgcagcatttactggaaccgtaggaatcaagccaacttat
ggacgttgttcgcggtggggaatcatagcttacgcctcatcacttgaccaagccggacct
attggacgcaccgttcaagattgtgcgattatgctcaaatcaatggcttcttttgacaaa
aaagattcaacttctgtagatttgcctgttcctgactacgaaagttatcttggcaaatca
attaaaggaatgaggattggtatcccaaaagaatatcaaattgaaggaatttcttcagaa
attattgaactttggcagaaaggggttcattggcttcaagaagcaggagctgaaattgtt
gatgtttcattgccccacacaaagtacgctttacctgcttactatatcgtagcttctgcg
gaggcatcttctaatttagcgcgctatgatggtgttcgctttgggcttcgtattccagga
aaagatattgttgaaatgtacgaaaatacgcgttctgcaggttttggtaatgaagttaaa
aggcgtattttaattggtacctatgttctttcagcgggatactatgatgcatattatcta
aaagctcaaaaagtacgtacattaattaagcatgattttgatcaatgtttttcctctggc
gttgatgcaattctcacacctgcaacaccaacacctgcttttggcattacggatgagaca
ataaaaaatgatgcaataacaatgtatcttaatgatatttttactgtgccggttaacatg
gtaggtttgcctgggatttctgttcctgcaggtttatcatcgagtggtcttcccctagga
ctacaattaataggcaagcctttttcagaagaagtcatttttcaggcggctcacattata
gagcaggcggctgggacattaagtgcagataaatggtggccgtaa

DBGET integrated database retrieval system