KEGG   Bartonella ancashensis: PU02_1287Help
Entry
PU02_1287         CDS       T04086                                 

Definition
(GenBank) 5-methyl-dCTP pyrophosphohydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
banc  Bartonella ancashensis
Brite
KEGG Orthology (KO) [BR:banc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:banc03400]
    PU02_1287
Enzymes [BR:banc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     PU02_1287
DNA repair and recombination proteins [BR:banc03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    PU02_1287
 Prokaryotic Type
    PU02_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: ALE04101
UniProt: A0A0M3T373
LinkDB All DBs
Position
complement(1401663..1402076)
Genome map
AA seq 137 aa AA seqDB search
MDVGGPLLLVVACALLNRDNKVLLAERPRGKPMAGLWEFPGGKIESGETPEESLVRELEE
ELGLYVQPKDLFPLSFASYSYETFHLLMPFYLCRHYEGIPQGREGQNLQWVFVNDLDQYP
MPIADKPLVKALKNYLF
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaggtggcccgcttcttcttgttgttgcatgcgcattattgaatcgagataac
aaggtattacttgcagagcggcctcggggaaaaccaatggctggcctctgggagtttcca
ggtgggaagattgagagtggtgaaacaccagaggaatcgttggttcgtgaattagaggaa
gaacttggtctttacgttcagcctaaagatttatttcccttgtcgtttgcgagttatagc
tatgagacatttcatctcttgatgccattttacctttgtcgccattatgagggtattcct
cagggcagagaggggcaaaatttgcagtgggtttttgttaatgatcttgatcaatatcct
atgcctattgcggataagccgctggtaaaagccctgaagaattatcttttttaa

DBGET integrated database retrieval system