KEGG   Bifidobacterium angulatum: BBAG_0627Help
Entry
BBAG_0627         CDS       T03930                                 

Definition
(GenBank) putative serine-threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bang  Bifidobacterium angulatum
Brite
KEGG Orthology (KO) [BR:bang00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bang01001]
    BBAG_0627
Enzymes [BR:bang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBAG_0627
Protein kinases [BR:bang01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBAG_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Pkinase_fungal UDPG_MGDP_dh_N Kdo
Motif
Other DBs
NCBI-ProteinID: BAQ96249
UniProt: C4FEG8
LinkDB All DBs
Position
complement(796826..798949)
Genome map
AA seq 707 aa AA seqDB search
MSEDASPQGQLIDGRYHVVREIAQGGMATVYEAIDERLNRTVALKVMHTQLAQGAHREQF
IERFRREAQSAAQIANPHIVQVYDTGEFNGLAYLVMEYVHGVNLRYEMNQQGTFTVRETL
RIIGETLEGLAAAHQVHVVHRDIKPENIMLNNRGRVQITDFGLAKVASAATLSSTGMLLG
TATYLPPETIEHNEATPQGDLYAVGIMAWEMLTGSVPFISDNPVTLVFKHVHEDVPSVAL
QCPDIDPAVARFIGHLTQRSVQARPADAGAALLELKQLCTSLEPNAWMYRKPSSTTDTAQ
TGTTPMPAPPAPPVQARSEESVPDATTAPMRPNATTPISEGSTQVLNAPDRSDGTATATT
AMPANGNGASKGTPAASSKRGRKALIIAVISLVVAVSCAGGAWWYFLGPGSYWKIPKPAD
VTCNADSACSLEGASWKQYERVLKNAGIPYSATKDYSDTVDEGHVISATVAGSPVAVDSH
VSMRQQQKVNVVVSKGMRMSTIPDDILDTASANGKSPLEALKHAGFTNIKHDTGKDEYSL
TAPEGTALSITPEPGTTLKHNAKVTVSLSKGPMPVTMPDIAGRAKDEASRALDDLKLKAT
FTEEFSDTVAAGEVISTSVPKDTQLHWGDAVEVTVSKGPETVTLPNVVGKTYDEASAMLK
ALGLDVKKSAPLGDLTHVVRLQSPSAGDQVRVRDSDGNKTVVTLTVV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagatgcatcaccccaaggccagctgatcgacggccgctaccatgttgtgcgc
gaaatcgcacagggaggcatggcgacggtatacgaggcgatcgacgaacgactgaaccgc
acggttgcgctgaaagtgatgcatacgcagttggcgcagggcgcgcatcgcgaacagttc
atcgaacggttccgcagggaggcgcagtcggcggcgcagatcgccaatcctcatatcgtg
caggtgtatgacaccggcgaattcaatggtcttgcctatctggtgatggaatacgtgcat
ggcgtgaatctgcgctatgaaatgaatcagcaggggaccttcaccgtgcgcgagacgctg
cgcatcatcggcgagaccctcgaggggcttgccgcggcgcatcaggtccatgtggtgcat
cgcgacatcaaacccgagaacatcatgctgaacaatcgcggccgtgtgcagatcaccgat
ttcggtctggccaaagtggcgtcggcggccacgctctcgtccaccggtatgctgctgggc
accgccacctatctgcctccggagaccatcgagcacaatgaggcgacgcctcagggcgac
ctgtatgccgtggggatcatggcatgggagatgctgaccggctcggtgccgttcatttcc
gacaatccggtgacgctggtgttcaagcatgtgcatgaggatgtgccgtccgtggcgtta
caatgccccgacatcgatccggcggtcgcccggttcatcgggcatctcacccagcgatcc
gtgcaggcccgcccggcggatgcgggtgctgcgctgctcgagctcaaacagttgtgtact
tcgcttgagccgaacgcatggatgtatcgcaagccctcttcgaccaccgatacggcacag
accggcacgacacccatgcccgctccaccggcacctcccgtacaggcgcgatccgaggaa
tccgtgcctgacgcgacgaccgcaccgatgcgtccgaacgccaccacgcccattagcgag
gggtccacgcaggtgctgaacgcaccggatcgaagcgatggcacggcaactgccacaacc
gccatgcccgccaacggcaacggcgcatcgaagggaacccccgccgcttcctcgaagcgc
gggaggaaagcgctgatcatcgccgtcatctcactggtcgtagccgtatcgtgcgcgggc
ggcgcatggtggtatttcctggggccgggaagctactggaagatccccaagccggccgat
gtgacctgcaatgcggactcggcatgctccttggaaggcgcctcctggaagcagtatgag
cgcgtgttgaagaatgccggcatcccctacagcgccaccaaggactacagcgataccgtc
gatgaggggcatgtgatttcggccacggtggcaggctctcccgtcgcggtcgacagccat
gtgagcatgcgacagcagcagaaggtgaatgtcgtggtttccaaaggcatgcgcatgtcg
acgattcccgacgatattctcgataccgccagcgccaacggcaaaagcccgctggaagcg
ctgaaacatgccggattcaccaatatcaaacatgacaccggcaaagacgagtattcactg
accgcccccgaaggcacggcattgtccatcaccccggagccaggcaccacgctcaagcac
aacgcaaaggttaccgtctcgttgagcaaggggcccatgccggtgaccatgccggatatt
gcaggccgcgcgaaggacgaagcgtcgcgggcacttgacgatctgaaattgaaggcgaca
ttcaccgaggaattcagcgataccgttgccgccggcgaagtaatctcgacatccgtgccc
aaggacacgcaactgcactggggcgatgccgtggaggtcacggtctccaagggcccggaa
accgtgacactgccgaatgtggttggcaaaacgtacgatgaggccagcgcaatgctgaag
gcgcttggcttggatgtgaagaaatcagcgccgttgggcgatctgacgcatgtcgttcgt
ctgcaaagccccagtgcaggcgatcaggtgcgcgtgcgcgacagcgacggcaacaaaacc
gtggtgacgctgaccgtcgtctga

DBGET integrated database retrieval system