KEGG   Bacillus anthracis HYU01: HYU01_01735Help
Entry
HYU01_01735       CDS       T03394                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
banh  Bacillus anthracis HYU01
Pathway
banh00970  Aminoacyl-tRNA biosynthesis
banh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:banh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYU01_01735 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:banh03029]
    HYU01_01735 (gatA)
Enzymes [BR:banh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HYU01_01735 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HYU01_01735 (gatA)
Mitochondrial biogenesis [BR:banh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HYU01_01735 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIF54785
UniProt: A0A0B5P2F8
LinkDB All DBs
Position
313645..315102
Genome map
AA seq 485 aa AA seqDB search
MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLTLDEENARAKAKELDA
KIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKILANFDPIYDATVVQKLKAADTITIGK
LNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAAGEVLFSLGSDTGGSIRQ
PAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAYLLQAISGLDRMDATSA
NVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLAALKVLEGMGATWEEVSLPH
SKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLMDLYKNTRSEGFGDEVKRRIML
GTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVIIGPTTPTPAFKVGEKVDDPMTM
YANDILTIPVNLAGVPAISVPCGFGANNMPLGLQIIGKHFDEATIYRVAHAFEQATDHHT
KKASL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatttgatcattcagtatcagagttacataagaagttaaacaacaaagaaatt
tccgttacggatttagtagaagaatcttacaaacgtattgcggatgttgaagataacgta
aaagcttttcttacattagatgaagaaaacgcacgcgcgaaagcgaaagaattagacgca
aaaattggcgctgaagataatggtttattatttggtatgccaatcggtgttaaagataac
attgtaactaacgggcttcgtacaacttgtgcgagcaaaatattagcaaacttcgatcca
atttatgatgcgacagttgtgcaaaagctaaaagctgctgacacaattacaatcggtaaa
ttaaatatggatgagttcgcaatgggttcttcaaatgaaaactcaggtttctacgctacg
aaaaatccatggaacttagattacgttccaggcggatctagtggtggttctgcagcagct
gtagcagcaggagaagtattattctctctaggttctgatacgggtggttctatccgtcag
ccagctgcatattgcggcgttgtaggtttaaaaccaacttacggacgcgtatctcgttac
ggattagtagcattcgcatcttcacttgaccaaatcggaccgattacacgtacagtagaa
gacaatgcatacttattacaagctatttcaggccttgaccgtatggatgcaacttctgca
aacgttgaagtaggaaactacttagctggtttaacaggcgacgttaaaggtttacgcatt
gctgtaccgaaagaatacttaggtgaaggtgttggcgaggaagcccgtgagtcagtgcta
gctgctttaaaagtattagaaggtatgggcgcaacttgggaggaagtatctcttccacac
tctaaatacgctctagcaacgtattacttactatcttcttctgaagcatctgctaacctt
tcacgcttcgacggcgtacgttacggcgttcgttctgacaatgtgaataacttaatggat
ctttacaaaaacacacgtagcgaaggcttcggtgatgaagttaaacgtcgtattatgctt
ggtacatttgcacttagctctggttactatgatgcatattacaaaaaggcacaacaagta
cgtacattaattaaaaacgactttgaaaatgtatttgctaactacgatgttattattgga
ccaactacgccaactccggcatttaaagtgggcgaaaaagttgatgatccaatgacaatg
tatgcaaatgacattttaacaatcccagtaaacttagcgggtgttccagcgatttctgtt
ccatgtggattcggtgctaacaacatgccacttggtctacaaatcattggtaaacacttc
gatgaagcgacaatttaccgcgttgcacatgcgtttgagcaagcaacagaccatcataca
aaaaaagcaagtctgtaa

DBGET integrated database retrieval system