KEGG   Bacillus anthracis HYU01: HYU01_03265Help
Entry
HYU01_03265       CDS       T03394                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
banh  Bacillus anthracis HYU01
Brite
KEGG Orthology (KO) [BR:banh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:banh01002]
    HYU01_03265
Enzymes [BR:banh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     HYU01_03265
Peptidases [BR:banh01002]
 Metallo Peptidases
  Family M4: thermolysin family
   HYU01_03265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AIF55044
UniProt: A0A2P0H9V8 Q81V99
LinkDB All DBs
Position
600649..602349
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRLQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPVKQEAPK
QEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQDNTRGATIFTYDAKNRSTL
PGTLWVDADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNRNSINDAGAPLKSTVHYGSRY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTEYSSDLIYQNESGALNEAISD
VFGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGTGDNGGV
HTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIYYRANTQYFTQSTTFSQARAGLVQ
AAADLYGASSAEVAAVKQSYSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcttttgcagattctaaaaatgtgctctctacgaagaagtacaatgag
acagtacagtcaccggagtttatttctggggatttaactgaagcaactggtaagaaagca
gaatctgttgtgtttgattacttaaatgcagcaaaaggtgattataagttaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagcgaagaaagatgctgtaactgattcaaca
gtattacgtttgcaacaagtttacgaaggagtacctgtatggggttctacgcaagtagct
cacgtaagtaaagatggttcattaaaagtattgtctggaacagttgcacctgatttagac
aaaaaagaaaagttgaaaaataaaaataagatcgaaggcgcaaaagcaattgaaattgcg
caaaaagatttaggtgttacacctaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatacgttgtaaatttaaacttcttagagcca
agcccaggaaactactactatttcattgaagcggacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataagtcaccagttaagcaagaggcacctaaa
caagaagcgaaaccggctgtaaagcctgtaacaggcacaaatgcagtgggtactggtaaa
ggtgtattaggagatacgaagtcacttaatacaacgttatctgcatcatcttactattta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaaccgctcaacatta
ccaggaacgttatgggtagatgcggataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcactactatgctggtagaacatatgattactataaagcgacatttaataga
aactctattaatgatgcaggagcaccattaaaatcaacagttcattatggaagtagatat
aataatgcgttctggaatggctctcaaatggtatacggagatggtgatggtgtaacattc
acttcattgtctggtggaattgatgtaattggccatgaattaacgcatgctgttacagag
tatagctcagatttaatttatcaaaatgaatcaggagcattaaatgaagctatttcagat
gtatttggtacattagtagagtattatgataaccgtaaccctgattgggaaattggtgaa
gatatttacacgcctggtaaagctggagatgcacttcgctctatgagtgatccaacgaaa
tatggtgatccagatcattattctaagcgttacacaggtactggtgataacggtggcgtt
catacaaatagcggtattattaacaaagcggcttacttactagcgaatggtggtacgcat
tacggtgttactgtaaacggtattggtaaagataaagtaggagcgatttattaccgtgca
aatacgcaatatttcacacaatctactacgtttagtcaagctcgtgctggattagtacaa
gctgcagctgacttatatggtgctagctctgcagaagtagcagcagttaagcaatcatat
agtgctgttggcgtaaactaa

DBGET integrated database retrieval system